276391

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 2111921..2112391 Replicon chromosome
Accession NZ_CP121513
Organism Staphylococcus epidermidis strain 20DL

Toxin (Protein)


Gene name TsaT Uniprot ID Q5HQS5
Locus tag QA605_RS09965 Protein ID WP_001829569.1
Coordinates 2112203..2112391 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID D4FNP2
Locus tag QA605_RS09960 Protein ID WP_002438963.1
Coordinates 2111921..2112178 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QA605_RS09920 2107285..2108001 - 717 WP_001831974.1 type I 3-dehydroquinate dehydratase -
QA605_RS09925 2108162..2108584 + 423 WP_002457221.1 organic hydroperoxide resistance protein -
QA605_RS09930 2108768..2108923 - 156 WP_001829648.1 hypothetical protein -
QA605_RS09935 2108935..2109122 - 188 Protein_1920 hypothetical protein -
QA605_RS09940 2109509..2110009 + 501 WP_001829623.1 GNAT family N-acetyltransferase -
QA605_RS09945 2110280..2110867 - 588 WP_001829615.1 histidine phosphatase family protein -
QA605_RS09950 2111081..2111317 + 237 WP_002457224.1 hypothetical protein -
QA605_RS09955 2111309..2111512 - 204 WP_002438966.1 sterile alpha motif-like domain-containing protein -
QA605_RS09960 2111921..2112178 + 258 WP_002438963.1 hypothetical protein Antitoxin
QA605_RS09965 2112203..2112391 + 189 WP_001829569.1 hypothetical protein Toxin
QA605_RS09970 2112581..2113135 + 555 WP_001829566.1 lipoprotein N-acylation protein LnsA -
QA605_RS09975 2113195..2113428 - 234 WP_001829664.1 hypothetical protein -
QA605_RS09980 2113712..2114458 + 747 WP_278275597.1 poly-gamma-glutamate hydrolase family protein -
QA605_RS09985 2114557..2114841 + 285 WP_001829635.1 hypothetical protein -
QA605_RS09990 2114865..2115089 + 225 WP_001829613.1 hypothetical protein -
QA605_RS09995 2115710..2115910 - 201 WP_001829681.1 cold-shock protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 2108768..2108923 155


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7229.94 Da        Isoelectric Point: 9.7844

>T276391 WP_001829569.1 NZ_CP121513:2112203-2112391 [Staphylococcus epidermidis]
MSLHFQILLWLSILFIIAGTILLVTMLKTKKEERKESYLGFTVIFLIFGFAILIYTFIFGIL

Download         Length: 189 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 10014.05 Da        Isoelectric Point: 4.5440

>AT276391 WP_002438963.1 NZ_CP121513:2111921-2112178 [Staphylococcus epidermidis]
MKLNKANIFNLIFTILFFSFNILITYNANIDYKLWLIPGLAICGFALFSSLTLVIIYSDLFSEILFFINIILALYYIYPI
FYEFV

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0N0LUH8

Antitoxin

Source ID Structure
AlphaFold DB A0A0U5IVM3

References