276387

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 2119479..2119949 Replicon chromosome
Accession NZ_CP121509
Organism Staphylococcus epidermidis strain 21FSE01

Toxin (Protein)


Gene name TsaT Uniprot ID Q5HQS5
Locus tag QA595_RS10040 Protein ID WP_001829569.1
Coordinates 2119761..2119949 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID D4FNP2
Locus tag QA595_RS10035 Protein ID WP_002438963.1
Coordinates 2119479..2119736 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QA595_RS09995 2114843..2115559 - 717 WP_001831974.1 type I 3-dehydroquinate dehydratase -
QA595_RS10000 2115720..2116142 + 423 WP_002457221.1 organic hydroperoxide resistance protein -
QA595_RS10005 2116326..2116481 - 156 WP_001829648.1 hypothetical protein -
QA595_RS10010 2116493..2116680 - 188 Protein_1935 hypothetical protein -
QA595_RS10015 2117067..2117567 + 501 WP_001829623.1 GNAT family N-acetyltransferase -
QA595_RS10020 2117838..2118425 - 588 WP_001829615.1 histidine phosphatase family protein -
QA595_RS10025 2118639..2118875 + 237 WP_002457224.1 hypothetical protein -
QA595_RS10030 2118867..2119070 - 204 WP_001829671.1 sterile alpha motif-like domain-containing protein -
QA595_RS10035 2119479..2119736 + 258 WP_002438963.1 hypothetical protein Antitoxin
QA595_RS10040 2119761..2119949 + 189 WP_001829569.1 hypothetical protein Toxin
QA595_RS10045 2120139..2120693 + 555 WP_001829566.1 lipoprotein N-acylation protein LnsA -
QA595_RS10050 2120753..2120986 - 234 WP_001829664.1 hypothetical protein -
QA595_RS10055 2121271..2122017 + 747 WP_001829580.1 poly-gamma-glutamate hydrolase family protein -
QA595_RS10060 2122116..2122400 + 285 WP_001829635.1 hypothetical protein -
QA595_RS10065 2122424..2122648 + 225 WP_001829613.1 hypothetical protein -
QA595_RS10070 2123269..2123469 - 201 WP_001829681.1 cold-shock protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2116326..2134736 18410
- flank IS/Tn - - 2116326..2116481 155


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7229.94 Da        Isoelectric Point: 9.7844

>T276387 WP_001829569.1 NZ_CP121509:2119761-2119949 [Staphylococcus epidermidis]
MSLHFQILLWLSILFIIAGTILLVTMLKTKKEERKESYLGFTVIFLIFGFAILIYTFIFGIL

Download         Length: 189 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 10014.05 Da        Isoelectric Point: 4.5440

>AT276387 WP_002438963.1 NZ_CP121509:2119479-2119736 [Staphylococcus epidermidis]
MKLNKANIFNLIFTILFFSFNILITYNANIDYKLWLIPGLAICGFALFSSLTLVIIYSDLFSEILFFINIILALYYIYPI
FYEFV

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0N0LUH8

Antitoxin

Source ID Structure
AlphaFold DB A0A0U5IVM3

References