Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 2202305..2202775 Replicon chromosome
Accession NZ_CP121507
Organism Staphylococcus epidermidis strain 23DSE01

Toxin (Protein)


Gene name TsaT Uniprot ID Q5HQS5
Locus tag QA588_RS10340 Protein ID WP_001829569.1
Coordinates 2202587..2202775 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID -
Locus tag QA588_RS10335 Protein ID WP_278267777.1
Coordinates 2202305..2202562 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QA588_RS10300 2197592..2197747 - 156 WP_001829648.1 hypothetical protein -
QA588_RS10305 2197759..2197946 - 188 Protein_1976 hypothetical protein -
QA588_RS10310 2198097..2199296 - 1200 WP_278269209.1 IS110-like element ISSep2 family transposase -
QA588_RS10315 2199893..2200393 + 501 WP_001829623.1 GNAT family N-acetyltransferase -
QA588_RS10320 2200664..2201251 - 588 WP_002469329.1 histidine phosphatase family protein -
QA588_RS10325 2201465..2201701 + 237 WP_002457224.1 hypothetical protein -
QA588_RS10330 2201693..2201896 - 204 WP_002438966.1 sterile alpha motif-like domain-containing protein -
QA588_RS10335 2202305..2202562 + 258 WP_278267777.1 hypothetical protein Antitoxin
QA588_RS10340 2202587..2202775 + 189 WP_001829569.1 hypothetical protein Toxin
QA588_RS10345 2202965..2203519 + 555 WP_002469327.1 lipoprotein N-acylation protein LnsA -
QA588_RS10350 2203579..2203812 - 234 WP_001829664.1 hypothetical protein -
QA588_RS10355 2204096..2204842 + 747 WP_002438959.1 poly-gamma-glutamate hydrolase family protein -
QA588_RS10360 2204941..2205225 + 285 WP_001829635.1 hypothetical protein -
QA588_RS10365 2205249..2205473 + 225 WP_001829613.1 hypothetical protein -
QA588_RS10370 2206094..2206294 - 201 WP_001829681.1 cold-shock protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7229.94 Da        Isoelectric Point: 9.7844

>T276383 WP_001829569.1 NZ_CP121507:2202587-2202775 [Staphylococcus epidermidis]
MSLHFQILLWLSILFIIAGTILLVTMLKTKKEERKESYLGFTVIFLIFGFAILIYTFIFGIL

Download         Length: 189 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 10040.09 Da        Isoelectric Point: 4.5440

>AT276383 WP_278267777.1 NZ_CP121507:2202305-2202562 [Staphylococcus epidermidis]
MKLNKANIFNLIFTILFFSFNILITYNPNIDYKLWLIPGLAICGFALFSSLTLVIIYSDLFSEILFFINIILALYYIYPI
FYEFV

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0N0LUH8

Antitoxin

Source ID Structure

References