Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 1429152..1429681 | Replicon | chromosome |
| Accession | NZ_CP121502 | ||
| Organism | Staphylococcus epidermidis strain 24FSE01 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | Q5HME7 |
| Locus tag | QA608_RS06845 | Protein ID | WP_001829891.1 |
| Coordinates | 1429152..1429514 (-) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | Q5HME6 |
| Locus tag | QA608_RS06850 | Protein ID | WP_001829931.1 |
| Coordinates | 1429511..1429681 (-) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QA608_RS06825 | 1426153..1426923 | - | 771 | WP_002468952.1 | RNA polymerase sigma factor SigB | - |
| QA608_RS06830 | 1426898..1427377 | - | 480 | WP_001829903.1 | anti-sigma B factor RsbW | - |
| QA608_RS06835 | 1427379..1427705 | - | 327 | WP_001829952.1 | anti-sigma factor antagonist | - |
| QA608_RS06840 | 1427805..1428806 | - | 1002 | WP_001829902.1 | PP2C family protein-serine/threonine phosphatase | - |
| QA608_RS06845 | 1429152..1429514 | - | 363 | WP_001829891.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| QA608_RS06850 | 1429511..1429681 | - | 171 | WP_001829931.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| QA608_RS06855 | 1429768..1430916 | - | 1149 | WP_002468951.1 | alanine racemase | - |
| QA608_RS06860 | 1430982..1431335 | - | 354 | WP_001829915.1 | holo-ACP synthase | - |
| QA608_RS06865 | 1431383..1431892 | - | 510 | WP_001829888.1 | PH domain-containing protein | - |
| QA608_RS06870 | 1431879..1433384 | - | 1506 | WP_001829976.1 | PH domain-containing protein | - |
| QA608_RS06875 | 1433377..1433856 | - | 480 | WP_278270020.1 | PH domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13497.65 Da Isoelectric Point: 9.9522
>T276378 WP_001829891.1 NZ_CP121502:c1429514-1429152 [Staphylococcus epidermidis]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTFLSESKMIEVDNALDISLGLNNFDHHKS
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTFLSESKMIEVDNALDISLGLNNFDHHKS
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2G7HWR0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0N1EF65 |