276376

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 307383..307853 Replicon chromosome
Accession NZ_CP121502
Organism Staphylococcus epidermidis strain 24FSE01

Toxin (Protein)


Gene name TsaT Uniprot ID Q5HQS5
Locus tag QA608_RS01475 Protein ID WP_001829569.1
Coordinates 307383..307571 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID D4FNP2
Locus tag QA608_RS01480 Protein ID WP_002438963.1
Coordinates 307596..307853 (-) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QA608_RS01445 303865..304065 + 201 WP_001829681.1 cold-shock protein -
QA608_RS01450 304686..304910 - 225 WP_001829613.1 hypothetical protein -
QA608_RS01455 304934..305218 - 285 WP_001829635.1 hypothetical protein -
QA608_RS01460 305317..306063 - 747 WP_278269757.1 poly-gamma-glutamate hydrolase family protein -
QA608_RS01465 306347..306580 + 234 WP_001829664.1 hypothetical protein -
QA608_RS01470 306640..307193 - 554 Protein_291 hypothetical protein -
QA608_RS01475 307383..307571 - 189 WP_001829569.1 hypothetical protein Toxin
QA608_RS01480 307596..307853 - 258 WP_002438963.1 hypothetical protein Antitoxin
QA608_RS01485 308262..308465 + 204 WP_002438966.1 sterile alpha motif-like domain-containing protein -
QA608_RS01490 308457..308693 - 237 WP_002457224.1 hypothetical protein -
QA608_RS01495 308905..309492 + 588 WP_001829615.1 histidine phosphatase family protein -
QA608_RS01500 309763..310263 - 501 WP_001829623.1 GNAT family N-acetyltransferase -
QA608_RS01505 310650..310837 + 188 Protein_298 hypothetical protein -
QA608_RS01510 310867..311004 + 138 WP_162161215.1 hypothetical protein -
QA608_RS01515 311188..311610 - 423 WP_002457221.1 organic hydroperoxide resistance protein -
QA608_RS01520 311771..312487 + 717 WP_001831974.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 310849..311004 155


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7229.94 Da        Isoelectric Point: 9.7844

>T276376 WP_001829569.1 NZ_CP121502:c307571-307383 [Staphylococcus epidermidis]
MSLHFQILLWLSILFIIAGTILLVTMLKTKKEERKESYLGFTVIFLIFGFAILIYTFIFGIL

Download         Length: 189 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 10014.05 Da        Isoelectric Point: 4.5440

>AT276376 WP_002438963.1 NZ_CP121502:c307853-307596 [Staphylococcus epidermidis]
MKLNKANIFNLIFTILFFSFNILITYNANIDYKLWLIPGLAICGFALFSSLTLVIIYSDLFSEILFFINIILALYYIYPI
FYEFV

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0N0LUH8

Antitoxin

Source ID Structure
AlphaFold DB A0A0U5IVM3

References