276375

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 2098819..2099289 Replicon chromosome
Accession NZ_CP121497
Organism Staphylococcus epidermidis strain 24FSE04

Toxin (Protein)


Gene name TsaT Uniprot ID Q5HQS5
Locus tag QA611_RS09960 Protein ID WP_001829569.1
Coordinates 2099101..2099289 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID D4FNP2
Locus tag QA611_RS09955 Protein ID WP_002438963.1
Coordinates 2098819..2099076 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QA611_RS09915 2094185..2094901 - 717 WP_001831974.1 type I 3-dehydroquinate dehydratase -
QA611_RS09920 2095062..2095484 + 423 WP_002457221.1 organic hydroperoxide resistance protein -
QA611_RS09925 2095668..2095805 - 138 WP_162161215.1 hypothetical protein -
QA611_RS09930 2095835..2096022 - 188 Protein_1901 hypothetical protein -
QA611_RS09935 2096409..2096909 + 501 WP_001829623.1 GNAT family N-acetyltransferase -
QA611_RS09940 2097180..2097767 - 588 WP_001829615.1 histidine phosphatase family protein -
QA611_RS09945 2097979..2098215 + 237 WP_002457224.1 hypothetical protein -
QA611_RS09950 2098207..2098410 - 204 WP_002438966.1 sterile alpha motif-like domain-containing protein -
QA611_RS09955 2098819..2099076 + 258 WP_002438963.1 hypothetical protein Antitoxin
QA611_RS09960 2099101..2099289 + 189 WP_001829569.1 hypothetical protein Toxin
QA611_RS09965 2099479..2100032 + 554 Protein_1908 hypothetical protein -
QA611_RS09970 2100092..2100325 - 234 WP_001829664.1 hypothetical protein -
QA611_RS09975 2100609..2101355 + 747 WP_278269757.1 poly-gamma-glutamate hydrolase family protein -
QA611_RS09980 2101454..2101737 + 284 Protein_1911 hypothetical protein -
QA611_RS09985 2101761..2101985 + 225 WP_001829613.1 hypothetical protein -
QA611_RS09990 2102606..2102806 - 201 WP_001829681.1 cold-shock protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 2095668..2095823 155


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7229.94 Da        Isoelectric Point: 9.7844

>T276375 WP_001829569.1 NZ_CP121497:2099101-2099289 [Staphylococcus epidermidis]
MSLHFQILLWLSILFIIAGTILLVTMLKTKKEERKESYLGFTVIFLIFGFAILIYTFIFGIL

Download         Length: 189 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 10014.05 Da        Isoelectric Point: 4.5440

>AT276375 WP_002438963.1 NZ_CP121497:2098819-2099076 [Staphylococcus epidermidis]
MKLNKANIFNLIFTILFFSFNILITYNANIDYKLWLIPGLAICGFALFSSLTLVIIYSDLFSEILFFINIILALYYIYPI
FYEFV

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0N0LUH8

Antitoxin

Source ID Structure
AlphaFold DB A0A0U5IVM3

References