Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 976974..977503 | Replicon | chromosome |
| Accession | NZ_CP121497 | ||
| Organism | Staphylococcus epidermidis strain 24FSE04 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | Q5HME7 |
| Locus tag | QA611_RS04595 | Protein ID | WP_001829891.1 |
| Coordinates | 977141..977503 (+) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | Q5HME6 |
| Locus tag | QA611_RS04590 | Protein ID | WP_001829931.1 |
| Coordinates | 976974..977144 (+) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QA611_RS04565 | 972799..973278 | + | 480 | WP_278270020.1 | PH domain-containing protein | - |
| QA611_RS04570 | 973271..974776 | + | 1506 | WP_001829976.1 | PH domain-containing protein | - |
| QA611_RS04575 | 974763..975272 | + | 510 | WP_001829888.1 | PH domain-containing protein | - |
| QA611_RS04580 | 975320..975673 | + | 354 | WP_001829915.1 | holo-ACP synthase | - |
| QA611_RS04585 | 975739..976887 | + | 1149 | WP_002468951.1 | alanine racemase | - |
| QA611_RS04590 | 976974..977144 | + | 171 | WP_001829931.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| QA611_RS04595 | 977141..977503 | + | 363 | WP_001829891.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| QA611_RS04600 | 977849..978850 | + | 1002 | WP_001829902.1 | PP2C family protein-serine/threonine phosphatase | - |
| QA611_RS04605 | 978950..979276 | + | 327 | WP_001829952.1 | anti-sigma factor antagonist | - |
| QA611_RS04610 | 979278..979757 | + | 480 | WP_001829903.1 | anti-sigma B factor RsbW | - |
| QA611_RS04615 | 979732..980502 | + | 771 | WP_002468952.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13497.65 Da Isoelectric Point: 9.9522
>T276373 WP_001829891.1 NZ_CP121497:977141-977503 [Staphylococcus epidermidis]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTFLSESKMIEVDNALDISLGLNNFDHHKS
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTFLSESKMIEVDNALDISLGLNNFDHHKS
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2G7HWR0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0N1EF65 |