276368

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 1415926..1416396 Replicon chromosome
Accession NZ_CP121486
Organism Staphylococcus epidermidis strain 32FSE02

Toxin (Protein)


Gene name TsaT Uniprot ID Q5HQS5
Locus tag QA591_RS06720 Protein ID WP_001829569.1
Coordinates 1415926..1416114 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID D4FNP2
Locus tag QA591_RS06725 Protein ID WP_002438963.1
Coordinates 1416139..1416396 (-) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QA591_RS06690 1412407..1412607 + 201 WP_001829681.1 cold-shock protein -
QA591_RS06695 1413228..1413452 - 225 WP_001829613.1 hypothetical protein -
QA591_RS06700 1413476..1413760 - 285 WP_001829635.1 hypothetical protein -
QA591_RS06705 1413859..1414605 - 747 WP_002495246.1 poly-gamma-glutamate hydrolase family protein -
QA591_RS06710 1414889..1415122 + 234 WP_001829664.1 hypothetical protein -
QA591_RS06715 1415182..1415736 - 555 WP_002495245.1 lipoprotein N-acylation protein LnsA -
QA591_RS06720 1415926..1416114 - 189 WP_001829569.1 hypothetical protein Toxin
QA591_RS06725 1416139..1416396 - 258 WP_002438963.1 hypothetical protein Antitoxin
QA591_RS06730 1416805..1417008 + 204 WP_002438966.1 sterile alpha motif-like domain-containing protein -
QA591_RS06735 1417000..1417236 - 237 WP_002457224.1 hypothetical protein -
QA591_RS06740 1417450..1418036 + 587 Protein_1306 histidine phosphatase family protein -
QA591_RS06745 1418307..1418807 - 501 WP_001829623.1 GNAT family N-acetyltransferase -
QA591_RS06750 1419194..1419381 + 188 Protein_1308 hypothetical protein -
QA591_RS06755 1419393..1419548 + 156 WP_001829648.1 hypothetical protein -
QA591_RS06760 1419732..1420154 - 423 WP_002457221.1 organic hydroperoxide resistance protein -
QA591_RS06765 1420315..1421031 + 717 WP_001831974.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1412407..1419548 7141
- flank IS/Tn - - 1419393..1419548 155


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7229.94 Da        Isoelectric Point: 9.7844

>T276368 WP_001829569.1 NZ_CP121486:c1416114-1415926 [Staphylococcus epidermidis]
MSLHFQILLWLSILFIIAGTILLVTMLKTKKEERKESYLGFTVIFLIFGFAILIYTFIFGIL

Download         Length: 189 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 10014.05 Da        Isoelectric Point: 4.5440

>AT276368 WP_002438963.1 NZ_CP121486:c1416396-1416139 [Staphylococcus epidermidis]
MKLNKANIFNLIFTILFFSFNILITYNANIDYKLWLIPGLAICGFALFSSLTLVIIYSDLFSEILFFINIILALYYIYPI
FYEFV

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0N0LUH8

Antitoxin

Source ID Structure
AlphaFold DB A0A0U5IVM3

References