Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 1142484..1142954 Replicon chromosome
Accession NZ_CP121483
Organism Staphylococcus epidermidis strain 32FSE07

Toxin (Protein)


Gene name TsaT Uniprot ID Q5HQS5
Locus tag QA590_RS05335 Protein ID WP_001829569.1
Coordinates 1142766..1142954 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID D4FNP2
Locus tag QA590_RS05330 Protein ID WP_002438963.1
Coordinates 1142484..1142741 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QA590_RS05300 1137938..1138125 - 188 Protein_1013 hypothetical protein -
QA590_RS05305 1138276..1139475 - 1200 WP_071813246.1 IS110-like element ISSep2 family transposase -
QA590_RS05310 1140072..1140572 + 501 WP_001829623.1 GNAT family N-acetyltransferase -
QA590_RS05315 1140843..1141430 - 588 WP_002468863.1 histidine phosphatase family protein -
QA590_RS05320 1141644..1141880 + 237 WP_002500396.1 hypothetical protein -
QA590_RS05325 1141872..1142075 - 204 WP_002438966.1 sterile alpha motif-like domain-containing protein -
QA590_RS05330 1142484..1142741 + 258 WP_002438963.1 hypothetical protein Antitoxin
QA590_RS05335 1142766..1142954 + 189 WP_001829569.1 hypothetical protein Toxin
QA590_RS05340 1143144..1143698 + 555 WP_038399225.1 lipoprotein N-acylation protein LnsA -
QA590_RS05345 1143758..1143991 - 234 WP_001829664.1 hypothetical protein -
QA590_RS05350 1144275..1145021 + 747 WP_002438959.1 poly-gamma-glutamate hydrolase family protein -
QA590_RS05355 1145120..1145404 + 285 WP_001829635.1 hypothetical protein -
QA590_RS05360 1145428..1145652 + 225 WP_001829613.1 hypothetical protein -
QA590_RS05365 1146273..1146473 - 201 WP_001829681.1 cold-shock protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 1138276..1139349 1073


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7229.94 Da        Isoelectric Point: 9.7844

>T276363 WP_001829569.1 NZ_CP121483:1142766-1142954 [Staphylococcus epidermidis]
MSLHFQILLWLSILFIIAGTILLVTMLKTKKEERKESYLGFTVIFLIFGFAILIYTFIFGIL

Download         Length: 189 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 10014.05 Da        Isoelectric Point: 4.5440

>AT276363 WP_002438963.1 NZ_CP121483:1142484-1142741 [Staphylococcus epidermidis]
MKLNKANIFNLIFTILFFSFNILITYNANIDYKLWLIPGLAICGFALFSSLTLVIIYSDLFSEILFFINIILALYYIYPI
FYEFV

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0N0LUH8

Antitoxin

Source ID Structure
AlphaFold DB A0A0U5IVM3

References