Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tsbAT/- |
Location | 152069..152871 | Replicon | chromosome |
Accession | NZ_CP121483 | ||
Organism | Staphylococcus epidermidis strain 32FSE07 |
Toxin (Protein)
Gene name | tsbT | Uniprot ID | Q5HN83 |
Locus tag | QA590_RS00830 | Protein ID | WP_002468490.1 |
Coordinates | 152692..152871 (+) | Length | 60 a.a. |
Antitoxin (Protein)
Gene name | tsbA | Uniprot ID | - |
Locus tag | QA590_RS00825 | Protein ID | WP_002486232.1 |
Coordinates | 152069..152668 (+) | Length | 200 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QA590_RS00800 | 147282..148739 | + | 1458 | WP_049376839.1 | ABC transporter substrate-binding protein/permease | - |
QA590_RS00805 | 148732..149454 | + | 723 | WP_001829838.1 | amino acid ABC transporter ATP-binding protein | - |
QA590_RS00810 | 149951..150100 | + | 150 | WP_002468809.1 | hypothetical protein | - |
QA590_RS00815 | 150314..151444 | + | 1131 | WP_001829814.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
QA590_RS00820 | 151441..151911 | + | 471 | WP_001829836.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
QA590_RS00825 | 152069..152668 | + | 600 | WP_002486232.1 | glucosamine-6-phosphate isomerase | Antitoxin |
QA590_RS00830 | 152692..152871 | + | 180 | WP_002468490.1 | SAS053 family protein | Toxin |
QA590_RS00835 | 153027..153431 | + | 405 | WP_002485605.1 | hypothetical protein | - |
QA590_RS00840 | 153616..155001 | + | 1386 | WP_001829862.1 | class II fumarate hydratase | - |
QA590_RS00845 | 155362..156186 | - | 825 | WP_001829804.1 | RluA family pseudouridine synthase | - |
QA590_RS00850 | 156345..157478 | + | 1134 | WP_001829819.1 | GAF domain-containing sensor histidine kinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6963.56 Da Isoelectric Point: 4.3016
>T276362 WP_002468490.1 NZ_CP121483:152692-152871 [Staphylococcus epidermidis]
MANKKDSKLNYHEEENAMVTDLDDLKELGKEMEQISQENDEEKLNQSHDNEVRSDLKKQ
MANKKDSKLNYHEEENAMVTDLDDLKELGKEMEQISQENDEEKLNQSHDNEVRSDLKKQ
Download Length: 180 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22695.55 Da Isoelectric Point: 4.8641
>AT276362 WP_002486232.1 NZ_CP121483:152069-152668 [Staphylococcus epidermidis]
MAMNFKVFDNSEKVAEYTADILRKQFNNNPTTIAGFHLSKEHAPVFDELKKNVENHTVDFSQINILDYDDNHSYYEALGV
PTGQIYSISYENDAIDFISDKIKTKENKGKLTMQVLTIDENGNLDISVRQGLMEAREIFLVITGANKRDMVEKLYRENGK
TSFEPSDLKAHRMVNVILDKEAAAGLPEDVKEYFTARFA
MAMNFKVFDNSEKVAEYTADILRKQFNNNPTTIAGFHLSKEHAPVFDELKKNVENHTVDFSQINILDYDDNHSYYEALGV
PTGQIYSISYENDAIDFISDKIKTKENKGKLTMQVLTIDENGNLDISVRQGLMEAREIFLVITGANKRDMVEKLYRENGK
TSFEPSDLKAHRMVNVILDKEAAAGLPEDVKEYFTARFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|