276359

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 1128257..1128727 Replicon chromosome
Accession NZ_CP121480
Organism Staphylococcus epidermidis strain 47FSE01

Toxin (Protein)


Gene name TsaT Uniprot ID Q5HQS5
Locus tag QA589_RS05380 Protein ID WP_001829569.1
Coordinates 1128539..1128727 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID D4FNP2
Locus tag QA589_RS05375 Protein ID WP_002438963.1
Coordinates 1128257..1128514 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QA589_RS05335 1123621..1124337 - 717 WP_001831974.1 type I 3-dehydroquinate dehydratase -
QA589_RS05340 1124498..1124920 + 423 WP_002457221.1 organic hydroperoxide resistance protein -
QA589_RS05345 1125104..1125259 - 156 WP_001829648.1 hypothetical protein -
QA589_RS05350 1125271..1125458 - 188 Protein_1023 hypothetical protein -
QA589_RS05355 1125845..1126345 + 501 WP_001829623.1 GNAT family N-acetyltransferase -
QA589_RS05360 1126616..1127203 - 588 WP_001829615.1 histidine phosphatase family protein -
QA589_RS05365 1127417..1127653 + 237 WP_002457224.1 hypothetical protein -
QA589_RS05370 1127645..1127848 - 204 WP_002438966.1 sterile alpha motif-like domain-containing protein -
QA589_RS05375 1128257..1128514 + 258 WP_002438963.1 hypothetical protein Antitoxin
QA589_RS05380 1128539..1128727 + 189 WP_001829569.1 hypothetical protein Toxin
QA589_RS05385 1128917..1129471 + 555 WP_001829566.1 lipoprotein N-acylation protein LnsA -
QA589_RS05390 1129531..1129764 - 234 WP_001829664.1 hypothetical protein -
QA589_RS05395 1130048..1130794 + 747 WP_002438959.1 poly-gamma-glutamate hydrolase family protein -
QA589_RS05400 1130893..1131177 + 285 WP_001829635.1 hypothetical protein -
QA589_RS05405 1131201..1131425 + 225 WP_001829613.1 hypothetical protein -
QA589_RS05410 1132046..1132246 - 201 WP_001829681.1 cold-shock protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage fusB - 1119229..1159388 40159
- flank IS/Tn - - 1125104..1125259 155


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7229.94 Da        Isoelectric Point: 9.7844

>T276359 WP_001829569.1 NZ_CP121480:1128539-1128727 [Staphylococcus epidermidis]
MSLHFQILLWLSILFIIAGTILLVTMLKTKKEERKESYLGFTVIFLIFGFAILIYTFIFGIL

Download         Length: 189 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 10014.05 Da        Isoelectric Point: 4.5440

>AT276359 WP_002438963.1 NZ_CP121480:1128257-1128514 [Staphylococcus epidermidis]
MKLNKANIFNLIFTILFFSFNILITYNANIDYKLWLIPGLAICGFALFSSLTLVIIYSDLFSEILFFINIILALYYIYPI
FYEFV

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0N0LUH8

Antitoxin

Source ID Structure
AlphaFold DB A0A0U5IVM3

References