Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 1154577..1155047 Replicon chromosome
Accession NZ_CP121477
Organism Staphylococcus epidermidis strain 44DSE01

Toxin (Protein)


Gene name TsaT Uniprot ID Q5HQS5
Locus tag QA587_RS05540 Protein ID WP_001829569.1
Coordinates 1154859..1155047 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID D4FNP2
Locus tag QA587_RS05535 Protein ID WP_002438963.1
Coordinates 1154577..1154834 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QA587_RS05495 1149941..1150657 - 717 WP_001831974.1 type I 3-dehydroquinate dehydratase -
QA587_RS05500 1150818..1151240 + 423 WP_002457221.1 organic hydroperoxide resistance protein -
QA587_RS05505 1151424..1151561 - 138 WP_162161215.1 hypothetical protein -
QA587_RS05510 1151591..1151778 - 188 Protein_1053 hypothetical protein -
QA587_RS05515 1152165..1152665 + 501 WP_001829623.1 GNAT family N-acetyltransferase -
QA587_RS05520 1152936..1153523 - 588 WP_001829615.1 histidine phosphatase family protein -
QA587_RS05525 1153737..1153973 + 237 WP_002457224.1 hypothetical protein -
QA587_RS05530 1153965..1154168 - 204 WP_002438966.1 sterile alpha motif-like domain-containing protein -
QA587_RS05535 1154577..1154834 + 258 WP_002438963.1 hypothetical protein Antitoxin
QA587_RS05540 1154859..1155047 + 189 WP_001829569.1 hypothetical protein Toxin
QA587_RS05545 1155237..1155791 + 555 WP_001829566.1 lipoprotein N-acylation protein LnsA -
QA587_RS05550 1155851..1156084 - 234 WP_001829664.1 hypothetical protein -
QA587_RS05555 1156368..1157114 + 747 WP_002438959.1 poly-gamma-glutamate hydrolase family protein -
QA587_RS05560 1157213..1157497 + 285 WP_001829635.1 hypothetical protein -
QA587_RS05565 1157521..1157745 + 225 WP_001829613.1 hypothetical protein -
QA587_RS05570 1158366..1158566 - 201 WP_001829681.1 cold-shock protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7229.94 Da        Isoelectric Point: 9.7844

>T276357 WP_001829569.1 NZ_CP121477:1154859-1155047 [Staphylococcus epidermidis]
MSLHFQILLWLSILFIIAGTILLVTMLKTKKEERKESYLGFTVIFLIFGFAILIYTFIFGIL

Download         Length: 189 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 10014.05 Da        Isoelectric Point: 4.5440

>AT276357 WP_002438963.1 NZ_CP121477:1154577-1154834 [Staphylococcus epidermidis]
MKLNKANIFNLIFTILFFSFNILITYNANIDYKLWLIPGLAICGFALFSSLTLVIIYSDLFSEILFFINIILALYYIYPI
FYEFV

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0N0LUH8

Antitoxin

Source ID Structure
AlphaFold DB A0A0U5IVM3

References