Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/Phd(antitoxin) |
Location | 906909..907450 | Replicon | chromosome |
Accession | NZ_CP121476 | ||
Organism | Pseudomonas sp. 905_Psudmo1 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | P9K38_RS04095 | Protein ID | WP_278326091.1 |
Coordinates | 906909..907205 (-) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | P9K38_RS04100 | Protein ID | WP_021487971.1 |
Coordinates | 907193..907450 (-) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P9K38_RS04085 (P9K38_04085) | 904144..905586 | + | 1443 | WP_278326089.1 | TldD/PmbA family protein | - |
P9K38_RS04090 (P9K38_04090) | 905586..906905 | + | 1320 | WP_278326090.1 | metallopeptidase TldD-related protein | - |
P9K38_RS04095 (P9K38_04095) | 906909..907205 | - | 297 | WP_278326091.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P9K38_RS04100 (P9K38_04100) | 907193..907450 | - | 258 | WP_021487971.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
P9K38_RS04105 (P9K38_04105) | 907519..908643 | - | 1125 | WP_278326092.1 | class I SAM-dependent methyltransferase | - |
P9K38_RS04110 (P9K38_04110) | 908713..909489 | + | 777 | WP_059390426.1 | ferredoxin--NADP reductase | - |
P9K38_RS04115 (P9K38_04115) | 909490..910515 | - | 1026 | WP_021487974.1 | hemolysin family protein | - |
P9K38_RS04120 (P9K38_04120) | 910712..910960 | + | 249 | WP_021487975.1 | YdcH family protein | - |
P9K38_RS04125 (P9K38_04125) | 911029..911307 | + | 279 | WP_021487976.1 | DUF465 domain-containing protein | - |
P9K38_RS04130 (P9K38_04130) | 911383..911877 | - | 495 | WP_031306393.1 | GNAT family N-acetyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11451.30 Da Isoelectric Point: 5.6268
>T276350 WP_278326091.1 NZ_CP121476:c907205-906909 [Pseudomonas sp. 905_Psudmo1]
MAEIVWTNTALEQLDDLAQYIALDKPDAARALVRRVVETVSRLVDFPLSGRVPDELPHSVYREIVVPPCRIFYRYTDTTV
FIIHIMREERVLRAHMLE
MAEIVWTNTALEQLDDLAQYIALDKPDAARALVRRVVETVSRLVDFPLSGRVPDELPHSVYREIVVPPCRIFYRYTDTTV
FIIHIMREERVLRAHMLE
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|