Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1234600..1235517 | Replicon | chromosome |
Accession | NZ_CP121465 | ||
Organism | Bacillus velezensis strain YA215 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | - |
Locus tag | P9972_RS06480 | Protein ID | WP_025851786.1 |
Coordinates | 1234771..1235517 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | I2HQ14 |
Locus tag | P9972_RS06475 | Protein ID | WP_003154807.1 |
Coordinates | 1234600..1234770 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P9972_RS06435 (P9972_06435) | 1229831..1231453 | + | 1623 | WP_014304855.1 | pyocin knob domain-containing protein | - |
P9972_RS06440 (P9972_06440) | 1231466..1231774 | + | 309 | WP_224979391.1 | hypothetical protein | - |
P9972_RS06445 (P9972_06445) | 1231843..1232040 | + | 198 | WP_003154819.1 | XkdX family protein | - |
P9972_RS06450 (P9972_06450) | 1232097..1232858 | + | 762 | WP_043867020.1 | hypothetical protein | - |
P9972_RS06455 (P9972_06455) | 1232910..1233173 | + | 264 | WP_003154815.1 | hemolysin XhlA family protein | - |
P9972_RS06460 (P9972_06460) | 1233187..1233450 | + | 264 | WP_003154813.1 | phage holin | - |
P9972_RS06465 (P9972_06465) | 1233464..1234342 | + | 879 | WP_024085195.1 | N-acetylmuramoyl-L-alanine amidase | - |
P9972_RS06470 (P9972_06470) | 1234378..1234503 | - | 126 | WP_003154809.1 | hypothetical protein | - |
P9972_RS06475 (P9972_06475) | 1234600..1234770 | - | 171 | WP_003154807.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
P9972_RS06480 (P9972_06480) | 1234771..1235517 | - | 747 | WP_025851786.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
P9972_RS06485 (P9972_06485) | 1235621..1236619 | - | 999 | WP_003154805.1 | inorganic phosphate transporter | - |
P9972_RS06490 (P9972_06490) | 1236632..1237249 | - | 618 | WP_003154804.1 | DUF47 domain-containing protein | - |
P9972_RS06495 (P9972_06495) | 1237535..1238851 | - | 1317 | WP_003154801.1 | amino acid permease | - |
P9972_RS06500 (P9972_06500) | 1239174..1240124 | + | 951 | WP_043867021.1 | ring-cleaving dioxygenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29048.53 Da Isoelectric Point: 4.7003
>T276349 WP_025851786.1 NZ_CP121465:c1235517-1234771 [Bacillus velezensis]
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVVGAMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYGEKMNVTASL
CEYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQDRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVVGAMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYGEKMNVTASL
CEYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQDRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|