Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
| Location | 1522794..1523389 | Replicon | chromosome |
| Accession | NZ_CP121464 | ||
| Organism | Janthinobacterium rivuli strain DEMB2 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | - |
| Locus tag | P9875_RS06825 | Protein ID | WP_035828697.1 |
| Coordinates | 1523090..1523389 (-) | Length | 100 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | - |
| Locus tag | P9875_RS06820 | Protein ID | WP_035825229.1 |
| Coordinates | 1522794..1523090 (-) | Length | 99 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P9875_RS06800 (P9875_06800) | 1518255..1518704 | - | 450 | WP_035825219.1 | hypothetical protein | - |
| P9875_RS06805 (P9875_06805) | 1518964..1519623 | - | 660 | WP_278317905.1 | FxDxF family PEP-CTERM protein | - |
| P9875_RS06810 (P9875_06810) | 1519925..1522030 | - | 2106 | WP_278317906.1 | TonB-dependent siderophore receptor | - |
| P9875_RS06815 (P9875_06815) | 1522319..1522765 | + | 447 | WP_176388863.1 | response regulator | - |
| P9875_RS06820 (P9875_06820) | 1522794..1523090 | - | 297 | WP_035825229.1 | putative addiction module antidote protein | Antitoxin |
| P9875_RS06825 (P9875_06825) | 1523090..1523389 | - | 300 | WP_035828697.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| P9875_RS06835 (P9875_06835) | 1523812..1524657 | - | 846 | WP_099400788.1 | glutamate racemase | - |
| P9875_RS06840 (P9875_06840) | 1524723..1526264 | - | 1542 | WP_034784516.1 | fumarate hydratase | - |
| P9875_RS06845 (P9875_06845) | 1526346..1526963 | - | 618 | WP_099400789.1 | YqhA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11097.66 Da Isoelectric Point: 8.5106
>T276347 WP_035828697.1 NZ_CP121464:c1523389-1523090 [Janthinobacterium rivuli]
VKSIHTTATFDDWFSQLKDRKAFFRIQARIDRAEDGNFGDCKPVGGGVSEMRIDCGPGYRVYFTQRGMEIIILLAGGDKS
TQAKDIKTAQRLAQILQEV
VKSIHTTATFDDWFSQLKDRKAFFRIQARIDRAEDGNFGDCKPVGGGVSEMRIDCGPGYRVYFTQRGMEIIILLAGGDKS
TQAKDIKTAQRLAQILQEV
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|