Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/StbC(antitoxin) |
Location | 1285107..1285745 | Replicon | chromosome |
Accession | NZ_CP121464 | ||
Organism | Janthinobacterium rivuli strain DEMB2 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | P9875_RS05855 | Protein ID | WP_278317814.1 |
Coordinates | 1285329..1285745 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | P9875_RS05850 | Protein ID | WP_278317813.1 |
Coordinates | 1285107..1285316 (+) | Length | 70 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P9875_RS05835 (P9875_05835) | 1282449..1283687 | + | 1239 | WP_278317810.1 | bifunctional glutamate N-acetyltransferase/amino-acid acetyltransferase ArgJ | - |
P9875_RS05840 (P9875_05840) | 1283684..1284565 | + | 882 | WP_278317811.1 | ATP-binding protein | - |
P9875_RS05845 (P9875_05845) | 1284562..1284984 | + | 423 | WP_278317812.1 | NUDIX domain-containing protein | - |
P9875_RS05850 (P9875_05850) | 1285107..1285316 | + | 210 | WP_278317813.1 | DNA-binding protein | Antitoxin |
P9875_RS05855 (P9875_05855) | 1285329..1285745 | + | 417 | WP_278317814.1 | hypothetical protein | Toxin |
P9875_RS05860 (P9875_05860) | 1285769..1285960 | - | 192 | WP_034748814.1 | DNA gyrase inhibitor YacG | - |
P9875_RS05865 (P9875_05865) | 1285979..1286734 | - | 756 | WP_035824877.1 | cell division protein ZapD | - |
P9875_RS05870 (P9875_05870) | 1286797..1287444 | - | 648 | WP_278317815.1 | dephospho-CoA kinase | - |
P9875_RS05875 (P9875_05875) | 1287467..1288336 | - | 870 | WP_278317816.1 | A24 family peptidase | - |
P9875_RS05880 (P9875_05880) | 1288443..1289639 | - | 1197 | WP_278317817.1 | type II secretion system F family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 14844.25 Da Isoelectric Point: 6.2201
>T276346 WP_278317814.1 NZ_CP121464:1285329-1285745 [Janthinobacterium rivuli]
MPGYLLDADVIVAARKGGAVPAGVAGFFERVAPEMRYVPVQVIAQLRAGIQCSWRREAALEALALEGWLEAVLAEYAPRL
LEFDLDCALVCARLHGRGHAHGVDRQIAAMGIAYGLTVVSGRLDSFAAQGLRLENPFI
MPGYLLDADVIVAARKGGAVPAGVAGFFERVAPEMRYVPVQVIAQLRAGIQCSWRREAALEALALEGWLEAVLAEYAPRL
LEFDLDCALVCARLHGRGHAHGVDRQIAAMGIAYGLTVVSGRLDSFAAQGLRLENPFI
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|