Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
Location | 2975959..2976476 | Replicon | chromosome |
Accession | NZ_CP121463 | ||
Organism | Arthrobacter sp. Y-9 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | P9849_RS13470 | Protein ID | WP_278267242.1 |
Coordinates | 2976189..2976476 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | - |
Locus tag | P9849_RS13465 | Protein ID | WP_278267241.1 |
Coordinates | 2975959..2976192 (+) | Length | 78 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P9849_RS13445 (P9849_13445) | 2973092..2973766 | + | 675 | WP_278267237.1 | response regulator | - |
P9849_RS13450 (P9849_13450) | 2973822..2974472 | + | 651 | WP_278267238.1 | HAD-IA family hydrolase | - |
P9849_RS13455 (P9849_13455) | 2974499..2975056 | + | 558 | WP_278267239.1 | N-acetyltransferase | - |
P9849_RS13460 (P9849_13460) | 2975042..2975839 | - | 798 | WP_278267240.1 | SDR family oxidoreductase | - |
P9849_RS13465 (P9849_13465) | 2975959..2976192 | + | 234 | WP_278267241.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
P9849_RS13470 (P9849_13470) | 2976189..2976476 | + | 288 | WP_278267242.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P9849_RS13475 (P9849_13475) | 2976502..2976807 | - | 306 | WP_278267243.1 | hypothetical protein | - |
P9849_RS13480 (P9849_13480) | 2976884..2977882 | - | 999 | WP_278267244.1 | glycosyltransferase family 4 protein | - |
P9849_RS13485 (P9849_13485) | 2977879..2978271 | - | 393 | WP_278267245.1 | 6-carboxytetrahydropterin synthase | - |
P9849_RS13490 (P9849_13490) | 2978274..2979281 | - | 1008 | WP_278267246.1 | dehydrogenase | - |
P9849_RS13495 (P9849_13495) | 2979411..2980634 | - | 1224 | WP_278267247.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 10951.40 Da Isoelectric Point: 7.3566
>T276344 WP_278267242.1 NZ_CP121463:2976189-2976476 [Arthrobacter sp. Y-9]
MSFRLTPAARADLSSIWDYTAERWDTRQAETYIRELHAAMERIAEDPARGRTCDEIRAGYRKYAIGSHLIFYVVAADGVD
VIRVLHQRMDAGRHL
MSFRLTPAARADLSSIWDYTAERWDTRQAETYIRELHAAMERIAEDPARGRTCDEIRAGYRKYAIGSHLIFYVVAADGVD
VIRVLHQRMDAGRHL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|