Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higB-toxA/Tad-couple_hipB |
| Location | 6211799..6212475 | Replicon | chromosome |
| Accession | NZ_CP121445 | ||
| Organism | Anaerocolumna sp. AGMB13025 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | QA584_RS25985 | Protein ID | WP_278272004.1 |
| Coordinates | 6211799..6212164 (+) | Length | 122 a.a. |
Antitoxin (Protein)
| Gene name | toxA | Uniprot ID | - |
| Locus tag | QA584_RS25990 | Protein ID | WP_278272005.1 |
| Coordinates | 6212161..6212475 (+) | Length | 105 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QA584_RS25955 (QA584_25955) | 6207412..6207633 | - | 222 | WP_278271998.1 | hypothetical protein | - |
| QA584_RS25960 (QA584_25960) | 6208001..6208540 | - | 540 | WP_278271999.1 | RNA 2'-phosphotransferase | - |
| QA584_RS25965 (QA584_25965) | 6208542..6208691 | - | 150 | WP_278272000.1 | hypothetical protein | - |
| QA584_RS25970 (QA584_25970) | 6209031..6209243 | - | 213 | WP_278272001.1 | hypothetical protein | - |
| QA584_RS25975 (QA584_25975) | 6209257..6209559 | - | 303 | WP_278272002.1 | hypothetical protein | - |
| QA584_RS25980 (QA584_25980) | 6209574..6211133 | - | 1560 | WP_278272003.1 | EndoU domain-containing protein | - |
| QA584_RS25985 (QA584_25985) | 6211799..6212164 | + | 366 | WP_278272004.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QA584_RS25990 (QA584_25990) | 6212161..6212475 | + | 315 | WP_278272005.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| QA584_RS25995 (QA584_25995) | 6213440..6214078 | - | 639 | WP_278272006.1 | hypothetical protein | - |
| QA584_RS26000 (QA584_26000) | 6214075..6215589 | - | 1515 | WP_278272007.1 | hypothetical protein | - |
| QA584_RS26005 (QA584_26005) | 6216028..6216414 | - | 387 | WP_278272008.1 | hypothetical protein | - |
| QA584_RS26010 (QA584_26010) | 6216614..6217402 | - | 789 | WP_278272009.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 14515.79 Da Isoelectric Point: 10.3714
>T276342 WP_278272004.1 NZ_CP121445:6211799-6212164 [Anaerocolumna sp. AGMB13025]
MFKVIFYKDKSGNEPIKDFLLELSQKAQANKNDRIQFNKISAYIKALQTYGTRIGKPTVKHIDGDLWELRPLENRIFFFY
WRDNTFVLLHHFIKKSQKTPTKEIEQARANLKDFLERIDHK
MFKVIFYKDKSGNEPIKDFLLELSQKAQANKNDRIQFNKISAYIKALQTYGTRIGKPTVKHIDGDLWELRPLENRIFFFY
WRDNTFVLLHHFIKKSQKTPTKEIEQARANLKDFLERIDHK
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|