Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/YafQ-DinJ |
Location | 841119..841684 | Replicon | chromosome |
Accession | NZ_CP121445 | ||
Organism | Anaerocolumna sp. AGMB13025 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | QA584_RS03595 | Protein ID | WP_278273135.1 |
Coordinates | 841119..841409 (-) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | QA584_RS03600 | Protein ID | WP_278273136.1 |
Coordinates | 841406..841684 (-) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QA584_RS03580 (QA584_03580) | 838334..839404 | + | 1071 | WP_278273132.1 | ABC transporter permease | - |
QA584_RS03585 (QA584_03585) | 839506..840183 | + | 678 | WP_278273133.1 | ABC transporter ATP-binding protein | - |
QA584_RS03590 (QA584_03590) | 840786..840989 | + | 204 | WP_278273134.1 | MazG-like family protein | - |
QA584_RS03595 (QA584_03595) | 841119..841409 | - | 291 | WP_278273135.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
QA584_RS03600 (QA584_03600) | 841406..841684 | - | 279 | WP_278273136.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
QA584_RS03605 (QA584_03605) | 841807..842262 | - | 456 | WP_278273137.1 | GNAT family N-acetyltransferase | - |
QA584_RS03610 (QA584_03610) | 842917..844677 | + | 1761 | WP_278273138.1 | DUF2075 domain-containing protein | - |
QA584_RS03615 (QA584_03615) | 844684..845019 | + | 336 | WP_278273139.1 | nucleotide pyrophosphohydrolase | - |
QA584_RS03620 (QA584_03620) | 845279..846268 | - | 990 | WP_278273140.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11055.80 Da Isoelectric Point: 7.3580
>T276341 WP_278273135.1 NZ_CP121445:c841409-841119 [Anaerocolumna sp. AGMB13025]
MRETKLTVKLTTQFKKDYKLAMKRGLNISLLEDVITQLAMSEALPEKNKDHALSGDWVGHRECHIQPDWLLVYRVDDDVL
VLTLTRTGTHSDMFGK
MRETKLTVKLTTQFKKDYKLAMKRGLNISLLEDVITQLAMSEALPEKNKDHALSGDWVGHRECHIQPDWLLVYRVDDDVL
VLTLTRTGTHSDMFGK
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|