Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | AbkB-brnA/BrnT-BrnA |
| Location | 14651..15239 | Replicon | plasmid plas4_LRT |
| Accession | NZ_CP121379 | ||
| Organism | Acinetobacter baumannii strain LRT | ||
Toxin (Protein)
| Gene name | AbkB | Uniprot ID | - |
| Locus tag | P9J63_RS19490 | Protein ID | WP_278221572.1 |
| Coordinates | 14952..15239 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | brnA | Uniprot ID | A0A0U3TC92 |
| Locus tag | P9J63_RS19485 | Protein ID | WP_032038670.1 |
| Coordinates | 14651..14965 (-) | Length | 105 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P9J63_RS19460 (P9J63_19460) | 11087..11581 | - | 495 | WP_005175503.1 | MobC family plasmid mobilization relaxosome protein | - |
| P9J63_RS19465 (P9J63_19465) | 11952..12197 | - | 246 | WP_109292003.1 | hypothetical protein | - |
| P9J63_RS19470 (P9J63_19470) | 12346..12570 | + | 225 | WP_005401979.1 | hypothetical protein | - |
| P9J63_RS19475 (P9J63_19475) | 12729..13892 | + | 1164 | WP_068553174.1 | ATP-binding protein | - |
| P9J63_RS19480 (P9J63_19480) | 13889..14578 | + | 690 | WP_068553176.1 | hypothetical protein | - |
| P9J63_RS19485 (P9J63_19485) | 14651..14965 | - | 315 | WP_032038670.1 | BrnA antitoxin family protein | Antitoxin |
| P9J63_RS19490 (P9J63_19490) | 14952..15239 | - | 288 | WP_278221572.1 | BrnT family toxin | Toxin |
| P9J63_RS19495 (P9J63_19495) | 15468..15851 | - | 384 | WP_270901924.1 | hypothetical protein | - |
| P9J63_RS19500 (P9J63_19500) | 16483..17144 | + | 662 | Protein_14 | IS5 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..40316 | 40316 | |
| - | flank | IS/Tn | - | - | 16567..17097 | 530 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11261.72 Da Isoelectric Point: 6.4846
>T276340 WP_278221572.1 NZ_CP121379:c15239-14952 [Acinetobacter baumannii]
MKQYFEWDEAKNRKNQKKHDVSFETASLVFEDPLRISIQDRHTDGEERWQTIGKVKGVLMLLVAHTIFDEDDCEIIRIIS
ARQVTKAERNKYEHG
MKQYFEWDEAKNRKNQKKHDVSFETASLVFEDPLRISIQDRHTDGEERWQTIGKVKGVLMLLVAHTIFDEDDCEIIRIIS
ARQVTKAERNKYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|