Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/upstrm_HI1419-dnstrm_HI1420 |
Location | 15916..16504 | Replicon | plasmid plas1_LRT |
Accession | NZ_CP121376 | ||
Organism | Acinetobacter baumannii strain LRT |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A5K1MH32 |
Locus tag | P9J63_RS18325 | Protein ID | WP_000569859.1 |
Coordinates | 16208..16504 (-) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | P9J63_RS18320 | Protein ID | WP_000241337.1 |
Coordinates | 15916..16206 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P9J63_RS18300 (P9J63_18300) | 11665..12663 | + | 999 | WP_004740250.1 | zinc-binding alcohol dehydrogenase family protein | - |
P9J63_RS18305 (P9J63_18305) | 12684..12968 | + | 285 | WP_000156168.1 | putative quinol monooxygenase | - |
P9J63_RS18310 (P9J63_18310) | 13032..14255 | - | 1224 | WP_123794025.1 | IS256 family transposase | - |
P9J63_RS18320 (P9J63_18320) | 15916..16206 | - | 291 | WP_000241337.1 | putative addiction module antidote protein | Antitoxin |
P9J63_RS18325 (P9J63_18325) | 16208..16504 | - | 297 | WP_000569859.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P9J63_RS18330 (P9J63_18330) | 16841..18175 | - | 1335 | WP_032050497.1 | ISNCY family transposase | - |
P9J63_RS18335 (P9J63_18335) | 18320..19225 | - | 906 | WP_005130397.1 | aromatic amino acid DMT transporter YddG | - |
P9J63_RS18340 (P9J63_18340) | 19238..20530 | - | 1293 | WP_024436605.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..101824 | 101824 | |
- | inside | IScluster/Tn | - | - | 13032..18163 | 5131 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11554.35 Da Isoelectric Point: 8.5037
>T276338 WP_000569859.1 NZ_CP121376:c16504-16208 [Acinetobacter baumannii]
MIEIKRLPEFDEWLDGLKDNMTRIRLNRRLDKVQRGNWGDIKPLQDGVWEMREFFGAGWRMYYIQHGDVVIVMLGGGEKS
TQKDDIKKAVKLSKTLED
MIEIKRLPEFDEWLDGLKDNMTRIRLNRRLDKVQRGNWGDIKPLQDGVWEMREFFGAGWRMYYIQHGDVVIVMLGGGEKS
TQKDDIKKAVKLSKTLED
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|