Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/- |
| Location | 3252873..3253526 | Replicon | chromosome |
| Accession | NZ_CP121370 | ||
| Organism | Acinetobacter baumannii strain LRB | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | P9J61_RS15925 | Protein ID | WP_032036174.1 |
| Coordinates | 3252873..3253262 (-) | Length | 130 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | V5V966 |
| Locus tag | P9J61_RS15930 | Protein ID | WP_001288210.1 |
| Coordinates | 3253269..3253526 (-) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P9J61_RS15910 (P9J61_15910) | 3248731..3250785 | + | 2055 | WP_004839673.1 | M3 family metallopeptidase | - |
| P9J61_RS15915 (P9J61_15915) | 3250826..3251035 | + | 210 | WP_032037922.1 | YheV family putative zinc ribbon protein | - |
| P9J61_RS15920 (P9J61_15920) | 3251154..3252086 | - | 933 | WP_001040037.1 | IS5-like element ISAha2 family transposase | - |
| P9J61_RS15925 (P9J61_15925) | 3252873..3253262 | - | 390 | WP_032036174.1 | membrane protein | Toxin |
| P9J61_RS15930 (P9J61_15930) | 3253269..3253526 | - | 258 | WP_001288210.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
| P9J61_RS15935 (P9J61_15935) | 3253714..3254886 | + | 1173 | WP_031961342.1 | acyl-CoA dehydrogenase family protein | - |
| P9J61_RS15940 (P9J61_15940) | 3254935..3256425 | - | 1491 | WP_032036176.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| P9J61_RS15945 (P9J61_15945) | 3256607..3256984 | - | 378 | WP_001216380.1 | 50S ribosomal protein L17 | - |
| P9J61_RS15950 (P9J61_15950) | 3257003..3258010 | - | 1008 | WP_000198631.1 | DNA-directed RNA polymerase subunit alpha | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 3251154..3252086 | 932 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 15641.96 Da Isoelectric Point: 10.5620
>T276331 WP_032036174.1 NZ_CP121370:c3253262-3252873 [Acinetobacter baumannii]
MINHLNFKLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLTQIAYLDKKLWSLAYQSQNTV
SRVKILKIIDYQIFIVIYFEGHKTLTSIIWFDQMSLAKWKKLKTLEKLY
MINHLNFKLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLTQIAYLDKKLWSLAYQSQNTV
SRVKILKIIDYQIFIVIYFEGHKTLTSIIWFDQMSLAKWKKLKTLEKLY
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|