Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 2184947..2185626 | Replicon | chromosome |
| Accession | NZ_CP121370 | ||
| Organism | Acinetobacter baumannii strain LRB | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S3TWT7 |
| Locus tag | P9J61_RS10775 | Protein ID | WP_000838146.1 |
| Coordinates | 2185444..2185626 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | N9L2H6 |
| Locus tag | P9J61_RS10770 | Protein ID | WP_000966688.1 |
| Coordinates | 2184947..2185351 (-) | Length | 135 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P9J61_RS10760 (P9J61_10760) | 2183903..2184166 | - | 264 | WP_001275792.1 | hypothetical protein | - |
| P9J61_RS10765 (P9J61_10765) | 2184168..2184848 | - | 681 | WP_264425998.1 | hypothetical protein | - |
| P9J61_RS10770 (P9J61_10770) | 2184947..2185351 | - | 405 | WP_000966688.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| P9J61_RS10775 (P9J61_10775) | 2185444..2185626 | - | 183 | WP_000838146.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| P9J61_RS10780 (P9J61_10780) | 2185952..2186467 | - | 516 | WP_099714910.1 | hypothetical protein | - |
| P9J61_RS10785 (P9J61_10785) | 2186537..2187454 | - | 918 | WP_099714908.1 | phage tail tube protein | - |
| P9J61_RS10790 (P9J61_10790) | 2187507..2188685 | - | 1179 | WP_264425994.1 | phage tail protein | - |
| P9J61_RS10795 (P9J61_10795) | 2188685..2189038 | - | 354 | WP_000064603.1 | hypothetical protein | - |
| P9J61_RS10800 (P9J61_10800) | 2189135..2189656 | - | 522 | WP_065708830.1 | SH3 domain-containing protein | - |
| P9J61_RS10805 (P9J61_10805) | 2189765..2189983 | - | 219 | WP_001277693.1 | hypothetical protein | - |
| P9J61_RS10810 (P9J61_10810) | 2189985..2190383 | - | 399 | WP_213070427.1 | phage tail terminator-like protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2167472..2217512 | 50040 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6695.84 Da Isoelectric Point: 10.5523
>T276330 WP_000838146.1 NZ_CP121370:c2185626-2185444 [Acinetobacter baumannii]
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTIPHPKKDLPNGTVKSILKQAGLN
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTIPHPKKDLPNGTVKSILKQAGLN
Download Length: 183 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14647.69 Da Isoelectric Point: 4.4328
>AT276330 WP_000966688.1 NZ_CP121370:c2185351-2184947 [Acinetobacter baumannii]
MLYPIAIERGSDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASELVKFVDDPEYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA
MLYPIAIERGSDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASELVKFVDDPEYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|