Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-YafN |
| Location | 15004..15529 | Replicon | plasmid plas4_Ab_8_4 |
| Accession | NZ_CP121369 | ||
| Organism | Acinetobacter baumannii strain Ab_8_4 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | P9J59_RS19530 | Protein ID | WP_005130374.1 |
| Coordinates | 15242..15529 (+) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | P9J59_RS19525 | Protein ID | WP_005130375.1 |
| Coordinates | 15004..15252 (+) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P9J59_RS19500 (P9J59_19500) | 12079..12993 | - | 915 | WP_004843977.1 | replication initiation protein RepM | - |
| P9J59_RS19505 (P9J59_19505) | 13444..14073 | + | 630 | WP_005130378.1 | AAA family ATPase | - |
| P9J59_RS19510 (P9J59_19510) | 14070..14309 | + | 240 | WP_005130377.1 | hypothetical protein | - |
| P9J59_RS19515 (P9J59_19515) | 14425..14493 | + | 69 | Protein_12 | helix-turn-helix domain-containing protein | - |
| P9J59_RS19520 (P9J59_19520) | 14576..15001 | + | 426 | WP_005130376.1 | hypothetical protein | - |
| P9J59_RS19525 (P9J59_19525) | 15004..15252 | + | 249 | WP_005130375.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| P9J59_RS19530 (P9J59_19530) | 15242..15529 | + | 288 | WP_005130374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| P9J59_RS19535 (P9J59_19535) | 15690..15839 | - | 150 | WP_079878061.1 | DUF4113 domain-containing protein | - |
| P9J59_RS19540 (P9J59_19540) | 16332..16898 | + | 567 | WP_004282045.1 | recombinase family protein | - |
| P9J59_RS19545 (P9J59_19545) | 17073..17405 | - | 333 | WP_005253224.1 | hypothetical protein | - |
| P9J59_RS19550 (P9J59_19550) | 17436..17957 | - | 522 | WP_109104475.1 | hypothetical protein | - |
| P9J59_RS19555 (P9J59_19555) | 18461..19301 | + | 841 | Protein_20 | IS3 family transposase | - |
| P9J59_RS19560 (P9J59_19560) | 19547..20335 | - | 789 | WP_004282048.1 | OmpA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..39272 | 39272 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11146.00 Da Isoelectric Point: 10.1961
>T276328 WP_005130374.1 NZ_CP121369:15242-15529 [Acinetobacter baumannii]
MTYKLDFLEEALAEWNKLNPSIKQPLKKKLIKVLENPRIPKNKLPGHPNRYKIKLRSVGYRLVYEVIDDEVIFIVIAVGR
RENNAVYDEANSRHS
MTYKLDFLEEALAEWNKLNPSIKQPLKKKLIKVLENPRIPKNKLPGHPNRYKIKLRSVGYRLVYEVIDDEVIFIVIAVGR
RENNAVYDEANSRHS
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|