Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/upstrm_HI1419-dnstrm_HI1420 |
Location | 85967..86555 | Replicon | plasmid plas1_Ab_8_4 |
Accession | NZ_CP121366 | ||
Organism | Acinetobacter baumannii strain Ab_8_4 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A5K1MH32 |
Locus tag | P9J59_RS18675 | Protein ID | WP_000569859.1 |
Coordinates | 85967..86263 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | P9J59_RS18680 | Protein ID | WP_000241337.1 |
Coordinates | 86265..86555 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P9J59_RS18660 (P9J59_18660) | 81941..83233 | + | 1293 | WP_024436605.1 | MFS transporter | - |
P9J59_RS18665 (P9J59_18665) | 83246..84151 | + | 906 | WP_005130397.1 | aromatic amino acid DMT transporter YddG | - |
P9J59_RS18670 (P9J59_18670) | 84296..85630 | + | 1335 | WP_032050497.1 | ISNCY family transposase | - |
P9J59_RS18675 (P9J59_18675) | 85967..86263 | + | 297 | WP_000569859.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P9J59_RS18680 (P9J59_18680) | 86265..86555 | + | 291 | WP_000241337.1 | putative addiction module antidote protein | Antitoxin |
P9J59_RS18685 (P9J59_18685) | 86917..88082 | + | 1166 | WP_085942227.1 | IS3-like element ISAba22 family transposase | - |
P9J59_RS18690 (P9J59_18690) | 88216..89439 | + | 1224 | WP_123794025.1 | IS256 family transposase | - |
P9J59_RS18695 (P9J59_18695) | 89503..89787 | - | 285 | WP_000156168.1 | putative quinol monooxygenase | - |
P9J59_RS18700 (P9J59_18700) | 89808..90806 | - | 999 | WP_004740250.1 | zinc-binding alcohol dehydrogenase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..101824 | 101824 | |
- | inside | IScluster/Tn | - | - | 84308..89439 | 5131 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11554.35 Da Isoelectric Point: 8.5037
>T276327 WP_000569859.1 NZ_CP121366:85967-86263 [Acinetobacter baumannii]
MIEIKRLPEFDEWLDGLKDNMTRIRLNRRLDKVQRGNWGDIKPLQDGVWEMREFFGAGWRMYYIQHGDVVIVMLGGGEKS
TQKDDIKKAVKLSKTLED
MIEIKRLPEFDEWLDGLKDNMTRIRLNRRLDKVQRGNWGDIKPLQDGVWEMREFFGAGWRMYYIQHGDVVIVMLGGGEKS
TQKDDIKKAVKLSKTLED
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|