Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/- |
Location | 3251579..3252232 | Replicon | chromosome |
Accession | NZ_CP121365 | ||
Organism | Acinetobacter baumannii strain Ab_8_4 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | P9J59_RS15925 | Protein ID | WP_032036174.1 |
Coordinates | 3251579..3251968 (-) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | V5V966 |
Locus tag | P9J59_RS15930 | Protein ID | WP_001288210.1 |
Coordinates | 3251975..3252232 (-) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P9J59_RS15910 (P9J59_15910) | 3247437..3249491 | + | 2055 | WP_004839673.1 | M3 family metallopeptidase | - |
P9J59_RS15915 (P9J59_15915) | 3249532..3249741 | + | 210 | WP_032037922.1 | YheV family putative zinc ribbon protein | - |
P9J59_RS15920 (P9J59_15920) | 3249860..3250792 | - | 933 | WP_001040037.1 | IS5-like element ISAha2 family transposase | - |
P9J59_RS15925 (P9J59_15925) | 3251579..3251968 | - | 390 | WP_032036174.1 | membrane protein | Toxin |
P9J59_RS15930 (P9J59_15930) | 3251975..3252232 | - | 258 | WP_001288210.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
P9J59_RS15935 (P9J59_15935) | 3252420..3253592 | + | 1173 | WP_031961342.1 | acyl-CoA dehydrogenase family protein | - |
P9J59_RS15940 (P9J59_15940) | 3253641..3255131 | - | 1491 | WP_032036176.1 | NAD(P)/FAD-dependent oxidoreductase | - |
P9J59_RS15945 (P9J59_15945) | 3255313..3255690 | - | 378 | WP_001216380.1 | 50S ribosomal protein L17 | - |
P9J59_RS15950 (P9J59_15950) | 3255709..3256716 | - | 1008 | WP_000198631.1 | DNA-directed RNA polymerase subunit alpha | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 3249860..3250792 | 932 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 15641.96 Da Isoelectric Point: 10.5620
>T276325 WP_032036174.1 NZ_CP121365:c3251968-3251579 [Acinetobacter baumannii]
MINHLNFKLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLTQIAYLDKKLWSLAYQSQNTV
SRVKILKIIDYQIFIVIYFEGHKTLTSIIWFDQMSLAKWKKLKTLEKLY
MINHLNFKLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLTQIAYLDKKLWSLAYQSQNTV
SRVKILKIIDYQIFIVIYFEGHKTLTSIIWFDQMSLAKWKKLKTLEKLY
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|