Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapB(antitoxin)
Location 40311..40885 Replicon plasmid pVP444
Accession NZ_CP121361
Organism Escherichia coli strain rl0044

Toxin (Protein)


Gene name vapC Uniprot ID A0A3A6SGD2
Locus tag P9060_RS28755 Protein ID WP_000604346.1
Coordinates 40311..40685 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A3A6S782
Locus tag P9060_RS28760 Protein ID WP_001261052.1
Coordinates 40682..40885 (-) Length 68 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P9060_RS28740 (P9060_28740) 38222..38764 + 543 WP_001005723.1 hypothetical protein -
P9060_RS28745 (P9060_28745) 39179..39488 + 310 Protein_39 transposase -
P9060_RS28750 (P9060_28750) 39572..40129 + 558 WP_000735639.1 Ail/Lom family outer membrane beta-barrel protein -
P9060_RS28755 (P9060_28755) 40311..40685 - 375 WP_000604346.1 PIN domain-containing protein Toxin
P9060_RS28760 (P9060_28760) 40682..40885 - 204 WP_001261052.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
P9060_RS28765 (P9060_28765) 40989..43001 - 2013 WP_000635641.1 relaxase/mobilization nuclease domain-containing protein -
P9060_RS28770 (P9060_28770) 43007..43342 - 336 WP_000045231.1 plasmid mobilization protein MobA -
P9060_RS28775 (P9060_28775) 43612..43926 + 315 WP_000741300.1 hypothetical protein -
P9060_RS28780 (P9060_28780) 44543..44713 + 171 WP_071881852.1 helix-turn-helix domain-containing protein -
P9060_RS28785 (P9060_28785) 44758..45388 - 631 Protein_47 DUF4942 domain-containing protein -
P9060_RS28790 (P9060_28790) 45443..45700 - 258 WP_000174705.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - hlyD / hlyB / hlyA / hlyC 1..67031 67031
- flank IS/Tn - - 39179..39331 152


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(2-114)

Antitoxin

Bacterial antitoxin of type II TA system, VapB

(1-44)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13911.31 Da        Isoelectric Point: 6.9672

>T276320 WP_000604346.1 NZ_CP121361:c40685-40311 [Escherichia coli]
MILVDTSVWVDHFKNKNDTLIQLLQSDFVLMHPMILAEIACGTPPAPRQRTLSDLDLLPKSHQATITEVLAFIENEKLFG
LGCGLVDITLLASTRITPGAKIWTLDKRLSRLAKHLNVEYQPVH

Download         Length: 375 bp

Antitoxin


Download         Length: 68 a.a.        Molecular weight: 7366.47 Da        Isoelectric Point: 6.2644

>AT276320 WP_001261052.1 NZ_CP121361:c40885-40682 [Escherichia coli]
MRTTVTIDDVLYAQALEMADPGMDKSDIFREAVKTFIRVQAAKRLASLGGAAPNMEITPRRRGDVAE

Download         Length: 204 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3A6SGD2

Antitoxin

Source ID Structure
AlphaFold DB A0A3A6S782

References