Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelE-RHH
Location 30455..31002 Replicon plasmid pVP443
Accession NZ_CP121360
Organism Escherichia coli strain rl0044

Toxin (Protein)


Gene name parE Uniprot ID G7QEJ9
Locus tag P9060_RS28140 Protein ID WP_001384452.1
Coordinates 30455..30733 (-) Length 93 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID A0A2I6FMZ7
Locus tag P9060_RS28145 Protein ID WP_000079930.1
Coordinates 30733..31002 (-) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P9060_RS28110 (25901) 25901..26275 + 375 WP_015675362.1 heat-labile enterotoxin LT subunit B -
P9060_RS28115 (26623) 26623..27019 + 397 Protein_32 ATP-binding protein -
P9060_RS28120 (27146) 27146..27990 + 845 Protein_33 IS3 family transposase -
P9060_RS28125 (28272) 28272..29348 + 1077 WP_000907656.1 IS110-like element ISEc21 family transposase -
P9060_RS28130 (29365) 29365..29673 + 309 Protein_35 integrase core domain-containing protein -
P9060_RS28135 (29680) 29680..30409 - 730 Protein_36 3'-5' exonuclease -
P9060_RS28140 (30455) 30455..30733 - 279 WP_001384452.1 type II toxin-antitoxin system toxin YacB Toxin
P9060_RS28145 (30733) 30733..31002 - 270 WP_000079930.1 type II toxin-antitoxin system antitoxin YacA Antitoxin
P9060_RS28150 (31919) 31919..32941 - 1023 WP_000840938.1 plasmid replication initiator RepA -
P9060_RS28155 (32934) 32934..33008 - 75 WP_032319616.1 RepA leader peptide Tap -
P9060_RS28160 (33242) 33242..33499 - 258 WP_000083834.1 replication regulatory protein RepA -
P9060_RS28165 (33779) 33779..33919 - 141 WP_064717426.1 Hok/Gef family protein -
P9060_RS28170 (33979) 33979..35147 + 1169 WP_085959723.1 IS3 family transposase -
- (35224) 35224..35285 + 62 NuclAT_1 - -
- (35224) 35224..35285 + 62 NuclAT_1 - -
- (35224) 35224..35285 + 62 NuclAT_1 - -
- (35224) 35224..35285 + 62 NuclAT_1 - -
P9060_RS28175 (35581) 35581..35892 + 312 WP_000765906.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - eltA / eltB 1..93908 93908
- inside IScluster/Tn - eltA / eltB 5745..35147 29402


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10762.38 Da        Isoelectric Point: 8.4615

>T276316 WP_001384452.1 NZ_CP121360:c30733-30455 [Escherichia coli]
MEIFWTMLASQDRKRIREYIAEQNLMAAIELDERIGYSASSLAGQPYKGRNGRVEGTRELVIHPHFVLVYEVDSQWGKVY
ILRVLHTAQKWP

Download         Length: 279 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10252.58 Da        Isoelectric Point: 7.2055

>AT276316 WP_000079930.1 NZ_CP121360:c31002-30733 [Escherichia coli]
MAQVNMSLRIDAELKDAFMAAAKSMDRNGSQLIRDFMRQTVERQHNTWFRDQVAAGRQQLERGDVLPHDMVESSAAAWRD
EMSRKVADK

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CL36

Antitoxin

Source ID Structure
AlphaFold DB A0A2I6FMZ7

References