Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
Location | 42358..42959 | Replicon | plasmid pVP441 |
Accession | NZ_CP121358 | ||
Organism | Escherichia coli strain rl0044 |
Toxin (Protein)
Gene name | doc | Uniprot ID | V0AJ64 |
Locus tag | P9060_RS27145 | Protein ID | WP_001216034.1 |
Coordinates | 42579..42959 (+) | Length | 127 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | U9YQH9 |
Locus tag | P9060_RS27140 | Protein ID | WP_001190712.1 |
Coordinates | 42358..42579 (+) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P9060_RS27085 (P9060_27085) | 37544..37783 | + | 240 | WP_000476201.1 | hypothetical protein | - |
P9060_RS27090 (P9060_27090) | 37780..38505 | + | 726 | WP_112987928.1 | ead/Ea22-like family protein | - |
P9060_RS27095 (P9060_27095) | 38507..38701 | + | 195 | WP_000224731.1 | hypothetical protein | - |
P9060_RS27100 (P9060_27100) | 38703..38881 | + | 179 | Protein_59 | hypothetical protein | - |
P9060_RS27105 (P9060_27105) | 39215..39787 | + | 573 | WP_097416341.1 | DUF551 domain-containing protein | - |
P9060_RS27110 (P9060_27110) | 39780..40061 | + | 282 | WP_000002100.1 | ASCH domain-containing protein | - |
P9060_RS27115 (P9060_27115) | 40085..40378 | + | 294 | WP_000267996.1 | hypothetical protein | - |
P9060_RS27120 (P9060_27120) | 40403..40612 | + | 210 | WP_085438024.1 | hypothetical protein | - |
P9060_RS27125 (P9060_27125) | 40609..41358 | + | 750 | WP_085438025.1 | hypothetical protein | - |
P9060_RS27130 (P9060_27130) | 41342..41626 | + | 285 | WP_096970304.1 | antitoxin PHD | - |
P9060_RS27135 (P9060_27135) | 41896..42285 | + | 390 | WP_000506727.1 | S24 family peptidase | - |
P9060_RS27140 (P9060_27140) | 42358..42579 | + | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
P9060_RS27145 (P9060_27145) | 42579..42959 | + | 381 | WP_001216034.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
P9060_RS27150 (P9060_27150) | 42964..43161 | + | 198 | WP_000113017.1 | hypothetical protein | - |
P9060_RS27155 (P9060_27155) | 43194..43970 | - | 777 | WP_054192288.1 | hypothetical protein | - |
P9060_RS27160 (P9060_27160) | 43977..44627 | - | 651 | WP_001108662.1 | DUF2829 domain-containing protein | - |
P9060_RS27165 (P9060_27165) | 44642..45136 | - | 495 | WP_054192289.1 | dUTP diphosphatase | - |
P9060_RS27170 (P9060_27170) | 45133..45609 | - | 477 | WP_096970305.1 | hypothetical protein | - |
P9060_RS27175 (P9060_27175) | 45606..45950 | - | 345 | WP_202603232.1 | hypothetical protein | - |
P9060_RS27180 (P9060_27180) | 46024..47052 | - | 1029 | WP_054192291.1 | tyrosine-type recombinase/integrase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..94075 | 94075 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13615.32 Da Isoelectric Point: 5.1514
>T276315 WP_001216034.1 NZ_CP121358:42579-42959 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0AJ64 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CJB6 |