Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 4551494..4552119 Replicon chromosome
Accession NZ_CP121355
Organism Mesorhizobium sp. WSM4906

Toxin (Protein)


Gene name hicA Uniprot ID -
Locus tag QAZ22_RS21850 Protein ID WP_278207903.1
Coordinates 4551494..4551685 (+) Length 64 a.a.

Antitoxin (Protein)


Gene name hicA Uniprot ID -
Locus tag QAZ22_RS21855 Protein ID WP_278202768.1
Coordinates 4551721..4552119 (+) Length 133 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QAZ22_RS21815 (QAZ22_21815) 4546690..4546881 - 192 WP_278202761.1 hypothetical protein -
QAZ22_RS21820 (QAZ22_21820) 4546892..4547236 - 345 WP_278202762.1 cupin domain-containing protein -
QAZ22_RS21825 (QAZ22_21825) 4547241..4548521 - 1281 WP_278202763.1 O-acetylhomoserine aminocarboxypropyltransferase -
QAZ22_RS21830 (QAZ22_21830) 4548682..4549203 - 522 WP_278202764.1 CoA-binding protein -
QAZ22_RS21835 (QAZ22_21835) 4549200..4549976 - 777 WP_278202765.1 AAA family ATPase -
QAZ22_RS21840 (QAZ22_21840) 4550017..4550838 - 822 WP_278202766.1 enoyl-CoA hydratase -
QAZ22_RS21845 (QAZ22_21845) 4550989..4551444 + 456 WP_278202767.1 PaaI family thioesterase -
QAZ22_RS21850 (QAZ22_21850) 4551494..4551685 + 192 WP_278207903.1 type II toxin-antitoxin system HicA family toxin Toxin
QAZ22_RS21855 (QAZ22_21855) 4551721..4552119 + 399 WP_278202768.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
QAZ22_RS21860 (QAZ22_21860) 4552168..4552761 - 594 WP_278202769.1 TetR/AcrR family transcriptional regulator -
QAZ22_RS21865 (QAZ22_21865) 4552853..4553254 + 402 WP_278202770.1 SRPBCC family protein -
QAZ22_RS21870 (QAZ22_21870) 4553547..4554011 + 465 WP_059184834.1 50S ribosomal protein L13 -
QAZ22_RS21875 (QAZ22_21875) 4554011..4554487 + 477 WP_278202771.1 30S ribosomal protein S9 -
QAZ22_RS21880 (QAZ22_21880) 4554499..4555527 - 1029 WP_278202772.1 acyltransferase -
QAZ22_RS21885 (QAZ22_21885) 4555756..4556667 - 912 WP_278202773.1 LysR family transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(6-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(4-124)


Sequences

Toxin        


Download         Length: 64 a.a.        Molecular weight: 7156.36 Da        Isoelectric Point: 10.9815

>T276287 WP_278207903.1 NZ_CP121355:4551494-4551685 [Mesorhizobium sp. WSM4906]
IERDSRKIVKRLKDDGFELVSVRGSHHKFRKGEIVLIVPHPEKDLPIGTARAIAKQAGWIKTN

Download         Length: 192 bp

Antitoxin


Download         Length: 133 a.a.        Molecular weight: 14067.91 Da        Isoelectric Point: 4.5129

>AT276287 WP_278202768.1 NZ_CP121355:4551721-4552119 [Mesorhizobium sp. WSM4906]
VKSYFALVDKDAGSAFGIRFPDIPGCFSAADAAEEIIPNAVEALQLWAEDMPVPEPSSHEAIVSLSEVRTALAEGAYLVS
VPLIDNDSAVVRANVTFERGVLRAIDAAARERGITRSAFLASAARKEIEAKH

Download         Length: 399 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References