Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
Location | 2864411..2865063 | Replicon | chromosome |
Accession | NZ_CP121355 | ||
Organism | Mesorhizobium sp. WSM4906 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QAZ22_RS13680 | Protein ID | WP_278207290.1 |
Coordinates | 2864411..2864800 (-) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | QAZ22_RS13685 | Protein ID | WP_278207291.1 |
Coordinates | 2864797..2865063 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QAZ22_RS13650 (QAZ22_13650) | 2859652..2859909 | - | 258 | WP_278207284.1 | hypothetical protein | - |
QAZ22_RS13655 (QAZ22_13655) | 2859938..2860576 | - | 639 | WP_278207285.1 | FMN-dependent NADH-azoreductase | - |
QAZ22_RS13660 (QAZ22_13660) | 2860688..2861635 | + | 948 | WP_278207286.1 | LysR family transcriptional regulator | - |
QAZ22_RS13665 (QAZ22_13665) | 2861767..2862711 | - | 945 | WP_278207287.1 | trypsin-like peptidase domain-containing protein | - |
QAZ22_RS13670 (QAZ22_13670) | 2862881..2863756 | + | 876 | WP_278207288.1 | S1C family serine protease | - |
QAZ22_RS13675 (QAZ22_13675) | 2863786..2864406 | + | 621 | WP_278207289.1 | helix-turn-helix transcriptional regulator | - |
QAZ22_RS13680 (QAZ22_13680) | 2864411..2864800 | - | 390 | WP_278207290.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QAZ22_RS13685 (QAZ22_13685) | 2864797..2865063 | - | 267 | WP_278207291.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
QAZ22_RS13690 (QAZ22_13690) | 2865222..2866088 | + | 867 | WP_278207292.1 | NAD(P)-dependent oxidoreductase | - |
QAZ22_RS13695 (QAZ22_13695) | 2866226..2866741 | - | 516 | WP_278207293.1 | TIGR00645 family protein | - |
QAZ22_RS13700 (QAZ22_13700) | 2867041..2869332 | - | 2292 | WP_278207294.1 | OmpA family protein | - |
QAZ22_RS13705 (QAZ22_13705) | 2869490..2869936 | + | 447 | WP_278207295.1 | YcgN family cysteine cluster protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 13925.05 Da Isoelectric Point: 5.1392
>T276285 WP_278207290.1 NZ_CP121355:c2864800-2864411 [Mesorhizobium sp. WSM4906]
VIIDSSALVAILRAEPGHDRLVQAIADAARRLIAAPTLLETSMVLAGGWQDEILDRLDALLRTASIETVAFTADHAAVAR
QAFLRYGKGRHPAALNFGDCIAYATARLEAMPLLFKGDDFRLTDIEPAI
VIIDSSALVAILRAEPGHDRLVQAIADAARRLIAAPTLLETSMVLAGGWQDEILDRLDALLRTASIETVAFTADHAAVAR
QAFLRYGKGRHPAALNFGDCIAYATARLEAMPLLFKGDDFRLTDIEPAI
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|