Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 5306445..5307118 | Replicon | chromosome |
Accession | NZ_CP121354 | ||
Organism | Mesorhizobium sp. WSM4904 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QAZ47_RS25710 | Protein ID | WP_278231217.1 |
Coordinates | 5306445..5306867 (-) | Length | 141 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | QAZ47_RS25715 | Protein ID | WP_278231218.1 |
Coordinates | 5306864..5307118 (-) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QAZ47_RS25665 (QAZ47_25665) | 5301691..5301969 | - | 279 | WP_278203524.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
QAZ47_RS25675 (QAZ47_25675) | 5302209..5302514 | - | 306 | WP_126084876.1 | ETC complex I subunit | - |
QAZ47_RS25680 (QAZ47_25680) | 5302830..5303810 | + | 981 | WP_278231212.1 | NAD(P)H-dependent oxidoreductase | - |
QAZ47_RS25685 (QAZ47_25685) | 5304048..5305217 | + | 1170 | WP_278231213.1 | NAD(P)/FAD-dependent oxidoreductase | - |
QAZ47_RS25695 (QAZ47_25695) | 5305436..5305573 | + | 138 | WP_278203527.1 | hypothetical protein | - |
QAZ47_RS25700 (QAZ47_25700) | 5305584..5305967 | - | 384 | WP_278231214.1 | type II toxin-antitoxin system VapC family toxin | - |
QAZ47_RS25705 (QAZ47_25705) | 5305964..5306221 | - | 258 | WP_278231215.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | - |
QAZ47_RS25710 (QAZ47_25710) | 5306445..5306867 | - | 423 | WP_278231217.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QAZ47_RS25715 (QAZ47_25715) | 5306864..5307118 | - | 255 | WP_278231218.1 | Arc family DNA-binding protein | Antitoxin |
QAZ47_RS25720 (QAZ47_25720) | 5307194..5307898 | - | 705 | WP_278203532.1 | DnaA regulatory inactivator HdaA | - |
QAZ47_RS25725 (QAZ47_25725) | 5307900..5309078 | - | 1179 | WP_278203533.1 | AI-2E family transporter | - |
QAZ47_RS25730 (QAZ47_25730) | 5309050..5309607 | - | 558 | WP_278231219.1 | CDP-alcohol phosphatidyltransferase family protein | - |
QAZ47_RS25735 (QAZ47_25735) | 5309905..5310984 | + | 1080 | WP_278231220.1 | phosphoribosylformylglycinamidine cyclo-ligase | - |
QAZ47_RS25740 (QAZ47_25740) | 5310981..5311688 | + | 708 | WP_278231221.1 | phosphoribosylglycinamide formyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 141 a.a. Molecular weight: 14898.27 Da Isoelectric Point: 5.6981
>T276281 WP_278231217.1 NZ_CP121354:c5306867-5306445 [Mesorhizobium sp. WSM4904]
MILLDTNVVSEMMRAEPHPAVLAWLDNQAAETLYLSSVTLAEILFGIEAMPAGRRKSALAEVFSGIFAVFDQRILVLDVE
AARRYAGLAVKARAAGKGFPVPDGYIAAIAAAKCFQVASRDTAPFHAAGVPVINPWDNAA
MILLDTNVVSEMMRAEPHPAVLAWLDNQAAETLYLSSVTLAEILFGIEAMPAGRRKSALAEVFSGIFAVFDQRILVLDVE
AARRYAGLAVKARAAGKGFPVPDGYIAAIAAAKCFQVASRDTAPFHAAGVPVINPWDNAA
Download Length: 423 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|