Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 4559179..4559804 Replicon chromosome
Accession NZ_CP121354
Organism Mesorhizobium sp. WSM4904

Toxin (Protein)


Gene name hicA Uniprot ID -
Locus tag QAZ47_RS21950 Protein ID WP_278207903.1
Coordinates 4559179..4559370 (+) Length 64 a.a.

Antitoxin (Protein)


Gene name hicA Uniprot ID -
Locus tag QAZ47_RS21955 Protein ID WP_278202768.1
Coordinates 4559406..4559804 (+) Length 133 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QAZ47_RS21915 (QAZ47_21915) 4554375..4554566 - 192 WP_278230687.1 hypothetical protein -
QAZ47_RS21920 (QAZ47_21920) 4554577..4554921 - 345 WP_278230688.1 cupin domain-containing protein -
QAZ47_RS21925 (QAZ47_21925) 4554926..4556206 - 1281 WP_278230689.1 O-acetylhomoserine aminocarboxypropyltransferase -
QAZ47_RS21930 (QAZ47_21930) 4556367..4556888 - 522 WP_278230690.1 CoA-binding protein -
QAZ47_RS21935 (QAZ47_21935) 4556885..4557661 - 777 WP_278202765.1 AAA family ATPase -
QAZ47_RS21940 (QAZ47_21940) 4557702..4558523 - 822 WP_278230691.1 enoyl-CoA hydratase -
QAZ47_RS21945 (QAZ47_21945) 4558674..4559129 + 456 WP_278202767.1 PaaI family thioesterase -
QAZ47_RS21950 (QAZ47_21950) 4559179..4559370 + 192 WP_278207903.1 type II toxin-antitoxin system HicA family toxin Toxin
QAZ47_RS21955 (QAZ47_21955) 4559406..4559804 + 399 WP_278202768.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
QAZ47_RS21960 (QAZ47_21960) 4559853..4560446 - 594 WP_278230692.1 TetR/AcrR family transcriptional regulator -
QAZ47_RS21965 (QAZ47_21965) 4560539..4560940 + 402 WP_278230693.1 SRPBCC family protein -
QAZ47_RS21970 (QAZ47_21970) 4561233..4561697 + 465 WP_278230694.1 50S ribosomal protein L13 -
QAZ47_RS21975 (QAZ47_21975) 4561697..4562173 + 477 WP_278077690.1 30S ribosomal protein S9 -
QAZ47_RS21980 (QAZ47_21980) 4562218..4563261 - 1044 WP_278230695.1 acyltransferase -
QAZ47_RS21985 (QAZ47_21985) 4563467..4564378 - 912 WP_278230696.1 LysR family transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(6-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(4-124)


Sequences

Toxin        


Download         Length: 64 a.a.        Molecular weight: 7156.36 Da        Isoelectric Point: 10.9815

>T276279 WP_278207903.1 NZ_CP121354:4559179-4559370 [Mesorhizobium sp. WSM4904]
IERDSRKIVKRLKDDGFELVSVRGSHHKFRKGEIVLIVPHPEKDLPIGTARAIAKQAGWIKTN

Download         Length: 192 bp

Antitoxin


Download         Length: 133 a.a.        Molecular weight: 14067.91 Da        Isoelectric Point: 4.5129

>AT276279 WP_278202768.1 NZ_CP121354:4559406-4559804 [Mesorhizobium sp. WSM4904]
VKSYFALVDKDAGSAFGIRFPDIPGCFSAADAAEEIIPNAVEALQLWAEDMPVPEPSSHEAIVSLSEVRTALAEGAYLVS
VPLIDNDSAVVRANVTFERGVLRAIDAAARERGITRSAFLASAARKEIEAKH

Download         Length: 399 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References