Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
Location | 2870315..2870967 | Replicon | chromosome |
Accession | NZ_CP121354 | ||
Organism | Mesorhizobium sp. WSM4904 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QAZ47_RS13740 | Protein ID | WP_278233615.1 |
Coordinates | 2870315..2870704 (-) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | QAZ47_RS13745 | Protein ID | WP_278207291.1 |
Coordinates | 2870701..2870967 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QAZ47_RS13710 (QAZ47_13710) | 2865579..2865809 | - | 231 | WP_278233610.1 | hypothetical protein | - |
QAZ47_RS13715 (QAZ47_13715) | 2865865..2866503 | - | 639 | WP_278233611.1 | FMN-dependent NADH-azoreductase | - |
QAZ47_RS13720 (QAZ47_13720) | 2866615..2867562 | + | 948 | WP_278233612.1 | LysR family transcriptional regulator | - |
QAZ47_RS13725 (QAZ47_13725) | 2867671..2868615 | - | 945 | WP_278207287.1 | trypsin-like peptidase domain-containing protein | - |
QAZ47_RS13730 (QAZ47_13730) | 2868785..2869660 | + | 876 | WP_278233613.1 | S1C family serine protease | - |
QAZ47_RS13735 (QAZ47_13735) | 2869690..2870310 | + | 621 | WP_278233614.1 | helix-turn-helix transcriptional regulator | - |
QAZ47_RS13740 (QAZ47_13740) | 2870315..2870704 | - | 390 | WP_278233615.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QAZ47_RS13745 (QAZ47_13745) | 2870701..2870967 | - | 267 | WP_278207291.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
QAZ47_RS13750 (QAZ47_13750) | 2871126..2871992 | + | 867 | WP_278233616.1 | NAD(P)-dependent oxidoreductase | - |
QAZ47_RS13755 (QAZ47_13755) | 2872130..2872645 | - | 516 | WP_278207293.1 | TIGR00645 family protein | - |
QAZ47_RS13760 (QAZ47_13760) | 2873008..2875266 | - | 2259 | WP_278233617.1 | OmpA family protein | - |
QAZ47_RS13765 (QAZ47_13765) | 2875461..2875907 | + | 447 | WP_278233618.1 | YcgN family cysteine cluster protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 13928.98 Da Isoelectric Point: 5.1392
>T276278 WP_278233615.1 NZ_CP121354:c2870704-2870315 [Mesorhizobium sp. WSM4904]
VIIDSSALVAILRAEPGHDRFVQAIADAARRLIAAPTLLETSTVLAGGWQDEILDRLDALLRTASIETVAFTADHAAVAR
QAFLRYGKGRHPAALNFGDCIAYATARLEAMPLLFKGDDFRLTDIEPAI
VIIDSSALVAILRAEPGHDRFVQAIADAARRLIAAPTLLETSTVLAGGWQDEILDRLDALLRTASIETVAFTADHAAVAR
QAFLRYGKGRHPAALNFGDCIAYATARLEAMPLLFKGDDFRLTDIEPAI
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|