Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 2661159..2661787 | Replicon | chromosome |
Accession | NZ_CP121354 | ||
Organism | Mesorhizobium sp. WSM4904 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QAZ47_RS12705 | Protein ID | WP_278233466.1 |
Coordinates | 2661401..2661787 (+) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | QAZ47_RS12700 | Protein ID | WP_126098270.1 |
Coordinates | 2661159..2661404 (+) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QAZ47_RS12675 (QAZ47_12675) | 2656888..2657976 | - | 1089 | WP_278233464.1 | AbrB family transcriptional regulator | - |
QAZ47_RS12680 (QAZ47_12680) | 2658045..2658356 | - | 312 | WP_278207101.1 | putative quinol monooxygenase | - |
QAZ47_RS12685 (QAZ47_12685) | 2658496..2659281 | - | 786 | WP_278207102.1 | SDR family oxidoreductase | - |
QAZ47_RS12690 (QAZ47_12690) | 2659353..2659787 | - | 435 | WP_278233465.1 | DsrE family protein | - |
QAZ47_RS12695 (QAZ47_12695) | 2659997..2661079 | + | 1083 | WP_278207104.1 | hypothetical protein | - |
QAZ47_RS12700 (QAZ47_12700) | 2661159..2661404 | + | 246 | WP_126098270.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
QAZ47_RS12705 (QAZ47_12705) | 2661401..2661787 | + | 387 | WP_278233466.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QAZ47_RS12710 (QAZ47_12710) | 2661790..2662737 | - | 948 | WP_278207107.1 | cation diffusion facilitator family transporter | - |
QAZ47_RS12715 (QAZ47_12715) | 2662743..2664932 | - | 2190 | WP_278233467.1 | anthranilate synthase | - |
QAZ47_RS12720 (QAZ47_12720) | 2665224..2666279 | - | 1056 | WP_278233468.1 | succinylglutamate desuccinylase/aspartoacylase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14273.41 Da Isoelectric Point: 5.2060
>T276277 WP_278233466.1 NZ_CP121354:2661401-2661787 [Mesorhizobium sp. WSM4904]
VIYLLDTNAVIAVMKGDDDLLTVLKRNKPQDFALSAIVVHELYYGAYRGQRTEENLARLDALLFPVLEFDREDARHAGEI
RAMLATSGTPIGPFDVLIGGQARARGLTLMTRNVREFERIGGLAIETW
VIYLLDTNAVIAVMKGDDDLLTVLKRNKPQDFALSAIVVHELYYGAYRGQRTEENLARLDALLFPVLEFDREDARHAGEI
RAMLATSGTPIGPFDVLIGGQARARGLTLMTRNVREFERIGGLAIETW
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|