Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1245865..1246544 | Replicon | chromosome |
| Accession | NZ_CP121345 | ||
| Organism | Acinetobacter baumannii strain 96 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S3TWT7 |
| Locus tag | PYY66_RS06070 | Protein ID | WP_000838146.1 |
| Coordinates | 1245865..1246047 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | N9L2H6 |
| Locus tag | PYY66_RS06075 | Protein ID | WP_000966688.1 |
| Coordinates | 1246140..1246544 (+) | Length | 135 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PYY66_RS06035 (PYY66_06035) | 1241062..1241505 | + | 444 | WP_002016455.1 | phage tail terminator-like protein | - |
| PYY66_RS06040 (PYY66_06040) | 1241507..1241725 | + | 219 | WP_001277696.1 | hypothetical protein | - |
| PYY66_RS06045 (PYY66_06045) | 1241834..1242355 | + | 522 | WP_000749909.1 | SH3 domain-containing protein | - |
| PYY66_RS06050 (PYY66_06050) | 1242452..1242805 | + | 354 | WP_000064593.1 | hypothetical protein | - |
| PYY66_RS06055 (PYY66_06055) | 1242805..1243983 | + | 1179 | WP_000002408.1 | hypothetical protein | - |
| PYY66_RS06060 (PYY66_06060) | 1244036..1244953 | + | 918 | WP_181596806.1 | phage tail tube protein | - |
| PYY66_RS06065 (PYY66_06065) | 1245024..1245539 | + | 516 | WP_024616020.1 | hypothetical protein | - |
| PYY66_RS06070 (PYY66_06070) | 1245865..1246047 | + | 183 | WP_000838146.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| PYY66_RS06075 (PYY66_06075) | 1246140..1246544 | + | 405 | WP_000966688.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| PYY66_RS06080 (PYY66_06080) | 1246644..1247168 | + | 525 | WP_000721574.1 | DUF4468 domain-containing protein | - |
| PYY66_RS06085 (PYY66_06085) | 1247233..1247616 | + | 384 | WP_000725052.1 | hypothetical protein | - |
| PYY66_RS06090 (PYY66_06090) | 1247678..1248424 | + | 747 | WP_000599537.1 | hypothetical protein | - |
| PYY66_RS06095 (PYY66_06095) | 1248510..1249001 | + | 492 | WP_000755583.1 | DUF4468 domain-containing protein | - |
| PYY66_RS06100 (PYY66_06100) | 1249044..1249310 | - | 267 | WP_000774879.1 | hypothetical protein | - |
| PYY66_RS06105 (PYY66_06105) | 1249460..1250395 | + | 936 | WP_000254125.1 | ORF6N domain-containing protein | - |
| PYY66_RS06110 (PYY66_06110) | 1250736..1251251 | + | 516 | WP_001056868.1 | Rha family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1214553..1265458 | 50905 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6695.84 Da Isoelectric Point: 10.5523
>T276274 WP_000838146.1 NZ_CP121345:1245865-1246047 [Acinetobacter baumannii]
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTIPHPKKDLPNGTVKSILKQAGLN
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTIPHPKKDLPNGTVKSILKQAGLN
Download Length: 183 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14647.69 Da Isoelectric Point: 4.4328
>AT276274 WP_000966688.1 NZ_CP121345:1246140-1246544 [Acinetobacter baumannii]
MLYPIAIERGSDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASELVKFVDDPEYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA
MLYPIAIERGSDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASELVKFVDDPEYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|