Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
Location | 2043545..2044074 | Replicon | chromosome |
Accession | NZ_CP121344 | ||
Organism | Corynebacterium glutamicum strain Cg21420 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | P9K31_RS09360 | Protein ID | WP_075348157.1 |
Coordinates | 2043545..2043844 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | A0A1B4WJV4 |
Locus tag | P9K31_RS09365 | Protein ID | WP_060564305.1 |
Coordinates | 2043841..2044074 (-) | Length | 78 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P9K31_RS09325 (P9K31_09325) | 2038888..2039466 | + | 579 | WP_060564312.1 | ATP-binding cassette domain-containing protein | - |
P9K31_RS09330 (P9K31_09330) | 2039471..2040496 | + | 1026 | WP_060564311.1 | hypothetical protein | - |
P9K31_RS09335 (P9K31_09335) | 2040646..2041029 | - | 384 | WP_060564310.1 | class I SAM-dependent methyltransferase | - |
P9K31_RS09340 (P9K31_09340) | 2041193..2041651 | - | 459 | WP_060564309.1 | NUDIX domain-containing protein | - |
P9K31_RS09345 (P9K31_09345) | 2041871..2042383 | + | 513 | WP_146144404.1 | hypothetical protein | - |
P9K31_RS09350 (P9K31_09350) | 2042465..2043022 | + | 558 | WP_060564307.1 | DUF6434 domain-containing protein | - |
P9K31_RS09355 (P9K31_09355) | 2043240..2043608 | - | 369 | WP_060564306.1 | helix-turn-helix domain-containing protein | - |
P9K31_RS09360 (P9K31_09360) | 2043545..2043844 | - | 300 | WP_075348157.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P9K31_RS09365 (P9K31_09365) | 2043841..2044074 | - | 234 | WP_060564305.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
P9K31_RS09370 (P9K31_09370) | 2044341..2044781 | - | 441 | WP_038583357.1 | YtoQ family protein | - |
P9K31_RS09375 (P9K31_09375) | 2045115..2045360 | - | 246 | WP_060564304.1 | hypothetical protein | - |
P9K31_RS09380 (P9K31_09380) | 2045525..2046610 | - | 1086 | WP_004568081.1 | redox-regulated ATPase YchF | - |
P9K31_RS09385 (P9K31_09385) | 2046806..2048029 | + | 1224 | WP_004568082.1 | alpha/beta hydrolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11529.07 Da Isoelectric Point: 10.6281
>T276272 WP_075348157.1 NZ_CP121344:c2043844-2043545 [Corynebacterium glutamicum]
VSRYLLTPAAQHDLSLIWDFTESRWGISQAKKYIREIQSAVEYVAQDANRGRSREEIRLGYKSTAVGSHVIFYVQRTSHW
KAMKQPVWRPTSARQFVTS
VSRYLLTPAAQHDLSLIWDFTESRWGISQAKKYIREIQSAVEYVAQDANRGRSREEIRLGYKSTAVGSHVIFYVQRTSHW
KAMKQPVWRPTSARQFVTS
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|