Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 349947..350617 | Replicon | plasmid unnamedB |
Accession | NZ_CP121310 | ||
Organism | Ensifer adhaerens strain Casida A-T305 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | P4B07_RS29695 | Protein ID | WP_034798590.1 |
Coordinates | 350198..350617 (+) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | P4B07_RS29690 | Protein ID | WP_034798588.1 |
Coordinates | 349947..350201 (+) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P4B07_RS29655 (P4B07_29655) | 344980..345663 | - | 684 | WP_082584643.1 | hypothetical protein | - |
P4B07_RS29660 (P4B07_29660) | 345810..346037 | + | 228 | WP_082936641.1 | helix-turn-helix domain-containing protein | - |
P4B07_RS29665 (P4B07_29665) | 346491..346899 | + | 409 | Protein_359 | hypothetical protein | - |
P4B07_RS29670 (P4B07_29670) | 346887..347138 | - | 252 | WP_063979521.1 | hypothetical protein | - |
P4B07_RS29675 (P4B07_29675) | 348068..349055 | + | 988 | Protein_361 | HWE histidine kinase domain-containing protein | - |
P4B07_RS29680 (P4B07_29680) | 349079..349432 | + | 354 | WP_034798587.1 | response regulator | - |
P4B07_RS29685 (P4B07_29685) | 349591..349770 | + | 180 | Protein_363 | DNA ligase | - |
P4B07_RS29690 (P4B07_29690) | 349947..350201 | + | 255 | WP_034798588.1 | plasmid stabilization protein | Antitoxin |
P4B07_RS29695 (P4B07_29695) | 350198..350617 | + | 420 | WP_034798590.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
P4B07_RS29700 (P4B07_29700) | 351270..352097 | + | 828 | WP_034798593.1 | transporter substrate-binding domain-containing protein | - |
P4B07_RS29705 (P4B07_29705) | 352157..353437 | + | 1281 | WP_082936642.1 | FAD-binding oxidoreductase | - |
P4B07_RS29710 (P4B07_29710) | 353467..354438 | + | 972 | WP_051659453.1 | amino acid ABC transporter permease | - |
P4B07_RS29715 (P4B07_29715) | 354446..355318 | + | 873 | WP_234798872.1 | DMT family transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | - | - | 1..1459375 | 1459375 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 14897.00 Da Isoelectric Point: 4.6556
>T276269 WP_034798590.1 NZ_CP121310:350198-350617 [Ensifer adhaerens]
MIVLDTNVVSEAMKPAPDLAVRNWLNDQVAETLFLSSVTLAELLFGIAALPEGRRKKALADTLDGLLELFDDRVLSFDTA
AARHYADLTATPRAVGKGFQTPDGYIAAIAASKGFTIATRDTSPFEAAGVPVVNPWNHL
MIVLDTNVVSEAMKPAPDLAVRNWLNDQVAETLFLSSVTLAELLFGIAALPEGRRKKALADTLDGLLELFDDRVLSFDTA
AARHYADLTATPRAVGKGFQTPDGYIAAIAASKGFTIATRDTSPFEAAGVPVVNPWNHL
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|