Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1086151..1086851 | Replicon | plasmid unnamedA |
Accession | NZ_CP121309 | ||
Organism | Ensifer adhaerens strain Casida A-T305 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | P4B07_RS24915 | Protein ID | WP_034800191.1 |
Coordinates | 1086414..1086851 (+) | Length | 146 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A1H0BN26 |
Locus tag | P4B07_RS24910 | Protein ID | WP_034800189.1 |
Coordinates | 1086151..1086417 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P4B07_RS24890 (P4B07_24890) | 1082490..1083539 | + | 1050 | WP_034800187.1 | ABC transporter permease | - |
P4B07_RS24895 (P4B07_24895) | 1083541..1084482 | + | 942 | WP_034800188.1 | ABC transporter permease | - |
P4B07_RS24900 (P4B07_24900) | 1084479..1085770 | + | 1292 | Protein_979 | amidohydrolase family protein | - |
P4B07_RS24905 (P4B07_24905) | 1085818..1085972 | - | 155 | Protein_980 | transcriptional regulator | - |
P4B07_RS24910 (P4B07_24910) | 1086151..1086417 | + | 267 | WP_034800189.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
P4B07_RS24915 (P4B07_24915) | 1086414..1086851 | + | 438 | WP_034800191.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
P4B07_RS24920 (P4B07_24920) | 1087128..1087376 | + | 249 | WP_034800193.1 | hypothetical protein | - |
P4B07_RS24925 (P4B07_24925) | 1087593..1088633 | + | 1041 | WP_034800195.1 | ABC transporter substrate-binding protein | - |
P4B07_RS24930 (P4B07_24930) | 1088759..1089523 | + | 765 | WP_060529703.1 | ABC transporter permease | - |
P4B07_RS24935 (P4B07_24935) | 1089539..1090342 | + | 804 | WP_034800199.1 | ABC transporter permease | - |
P4B07_RS24940 (P4B07_24940) | 1090339..1091427 | + | 1089 | WP_034800202.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | katA | 1..1736931 | 1736931 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 146 a.a. Molecular weight: 15304.68 Da Isoelectric Point: 6.9280
>T276266 WP_034800191.1 NZ_CP121309:1086414-1086851 [Ensifer adhaerens]
VSNLFMLDTNIVSELARNPRGQVAERIAAVGSEAICVSIITAAELRYGCAKKGSPKLLAQIEALLESILVLALDVPADAK
YGNIRTELEAAGKPIGPNDLLIAAHACAAGAVLVTANAREFTRIPNLRVENWLDATSKQLRGASN
VSNLFMLDTNIVSELARNPRGQVAERIAAVGSEAICVSIITAAELRYGCAKKGSPKLLAQIEALLESILVLALDVPADAK
YGNIRTELEAAGKPIGPNDLLIAAHACAAGAVLVTANAREFTRIPNLRVENWLDATSKQLRGASN
Download Length: 438 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|