Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3751704..3752324 | Replicon | chromosome |
Accession | NZ_CP121298 | ||
Organism | Salmonella enterica subsp. enterica strain KKP 3080 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | P1839_RS18275 | Protein ID | WP_001280991.1 |
Coordinates | 3752106..3752324 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | P1839_RS18270 | Protein ID | WP_000344807.1 |
Coordinates | 3751704..3752078 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P1839_RS18260 (3746843) | 3746843..3748036 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
P1839_RS18265 (3748059) | 3748059..3751208 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
P1839_RS18270 (3751704) | 3751704..3752078 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
P1839_RS18275 (3752106) | 3752106..3752324 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
P1839_RS18280 (3752503) | 3752503..3753054 | + | 552 | WP_001278792.1 | maltose O-acetyltransferase | - |
P1839_RS18285 (3753171) | 3753171..3753641 | + | 471 | WP_000136181.1 | YlaC family protein | - |
P1839_RS18290 (3753697) | 3753697..3753837 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
P1839_RS18295 (3753843) | 3753843..3754103 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
P1839_RS18300 (3754328) | 3754328..3755878 | + | 1551 | WP_000213139.1 | EAL domain-containing protein | - |
P1839_RS18310 (3756109) | 3756109..3756498 | + | 390 | WP_000961285.1 | MGMT family protein | - |
P1839_RS18315 (3756531) | 3756531..3757100 | - | 570 | WP_000779803.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T276262 WP_001280991.1 NZ_CP121298:3752106-3752324 [Salmonella enterica subsp. enterica]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT276262 WP_000344807.1 NZ_CP121298:3751704-3752078 [Salmonella enterica subsp. enterica]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|