Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 1183992..1184652 | Replicon | chromosome |
Accession | NZ_CP121298 | ||
Organism | Salmonella enterica subsp. enterica strain KKP 3080 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | Q57K70 |
Locus tag | P1839_RS05730 | Protein ID | WP_000244756.1 |
Coordinates | 1184239..1184652 (+) | Length | 138 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S5MU13 |
Locus tag | P1839_RS05725 | Protein ID | WP_000351186.1 |
Coordinates | 1183992..1184258 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P1839_RS05705 (1179920) | 1179920..1181353 | - | 1434 | WP_278219240.1 | 6-phospho-beta-glucosidase BglA | - |
P1839_RS05710 (1181512) | 1181512..1181823 | + | 312 | WP_001182976.1 | N(4)-acetylcytidine aminohydrolase | - |
P1839_RS05715 (1181987) | 1181987..1182646 | + | 660 | WP_000250289.1 | hemolysin III family protein | - |
P1839_RS05720 (1182762) | 1182762..1183742 | - | 981 | WP_000874172.1 | tRNA-modifying protein YgfZ | - |
P1839_RS05725 (1183992) | 1183992..1184258 | + | 267 | WP_000351186.1 | FAD assembly factor SdhE | Antitoxin |
P1839_RS05730 (1184239) | 1184239..1184652 | + | 414 | WP_000244756.1 | protein YgfX | Toxin |
P1839_RS05735 (1184705) | 1184705..1185226 | - | 522 | WP_001055885.1 | flavodoxin FldB | - |
P1839_RS05740 (1185339) | 1185339..1186235 | + | 897 | WP_000434302.1 | site-specific tyrosine recombinase XerD | - |
P1839_RS05745 (1186259) | 1186259..1186972 | + | 714 | WP_000745625.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
P1839_RS05750 (1186978) | 1186978..1188711 | + | 1734 | WP_000813394.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 16183.15 Da Isoelectric Point: 10.7537
>T276254 WP_000244756.1 NZ_CP121298:1184239-1184652 [Salmonella enterica subsp. enterica]
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3Z1E9V5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0YWH4 |