Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 559246..560006 | Replicon | chromosome |
Accession | NZ_CP121298 | ||
Organism | Salmonella enterica subsp. enterica strain KKP 3080 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | Q57IH1 |
Locus tag | P1839_RS02675 | Protein ID | WP_000533909.1 |
Coordinates | 559521..560006 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | M7RHS4 |
Locus tag | P1839_RS02670 | Protein ID | WP_000965886.1 |
Coordinates | 559246..559533 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P1839_RS02645 (554541) | 554541..554843 | + | 303 | WP_000605590.1 | YsaB family lipoprotein | - |
P1839_RS02650 (554982) | 554982..555893 | + | 912 | WP_001168551.1 | glycine--tRNA ligase subunit alpha | - |
P1839_RS02655 (555903) | 555903..557972 | + | 2070 | WP_001291736.1 | glycine--tRNA ligase subunit beta | - |
P1839_RS02660 (558154) | 558154..558429 | + | 276 | Protein_502 | IS3 family transposase | - |
P1839_RS02665 (558601) | 558601..559068 | + | 468 | WP_000702452.1 | GNAT family N-acetyltransferase | - |
P1839_RS02670 (559246) | 559246..559533 | + | 288 | WP_000965886.1 | DUF1778 domain-containing protein | Antitoxin |
P1839_RS02675 (559521) | 559521..560006 | + | 486 | WP_000533909.1 | GNAT family N-acetyltransferase | Toxin |
P1839_RS02680 (560378) | 560378..560917 | - | 540 | WP_000047149.1 | copper-binding periplasmic metallochaperone CueP | - |
P1839_RS02685 (561091) | 561091..561303 | - | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
P1839_RS02690 (561592) | 561592..561882 | - | 291 | WP_000455790.1 | HTH-type transcriptional regulator | - |
P1839_RS02695 (562321) | 562321..563032 | + | 712 | Protein_509 | DUF3053 domain-containing protein | - |
P1839_RS02700 (563082) | 563082..564056 | - | 975 | WP_000804674.1 | glyoxylate/hydroxypyruvate reductase GhrB | - |
P1839_RS02705 (564275) | 564275..564937 | - | 663 | WP_000747548.1 | OmpA family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17703.41 Da Isoelectric Point: 9.8719
>T276252 WP_000533909.1 NZ_CP121298:559521-560006 [Salmonella enterica subsp. enterica]
VGRVTAPEPLSAFHQVAEFVSGEAVLDDWLKQKGLKNQALGAARTFVVCKKDTKQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDLSFHGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKSSQTQQRTLFLRLP
Q
VGRVTAPEPLSAFHQVAEFVSGEAVLDDWLKQKGLKNQALGAARTFVVCKKDTKQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDLSFHGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKSSQTQQRTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 7F36 | |
PDB | 7AK8 | |
PDB | 5FVJ |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V2JDX2 |