Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 3474859..3475673 | Replicon | chromosome |
| Accession | NZ_CP121297 | ||
| Organism | Salmonella enterica subsp. enterica strain KKP 1762 | ||
Toxin (Protein)
| Gene name | TacT3 | Uniprot ID | Q57KM2 |
| Locus tag | P1N06_RS16975 | Protein ID | WP_000971655.1 |
| Coordinates | 3475146..3475673 (+) | Length | 176 a.a. |
Antitoxin (Protein)
| Gene name | TacA3 | Uniprot ID | M7S6I2 |
| Locus tag | P1N06_RS16970 | Protein ID | WP_000855694.1 |
| Coordinates | 3474859..3475149 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1N06_RS16940 (3470788) | 3470788..3471438 | - | 651 | WP_001674874.1 | type III secretion system transcriptional activator InvF | - |
| P1N06_RS16945 (3471894) | 3471894..3472337 | + | 444 | WP_000715096.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
| P1N06_RS16950 (3472769) | 3472769..3473218 | + | 450 | WP_000381613.1 | hypothetical protein | - |
| P1N06_RS16955 (3473203) | 3473203..3473550 | + | 348 | WP_001555786.1 | DUF1493 family protein | - |
| P1N06_RS16960 (3473823) | 3473823..3474149 | - | 327 | WP_076737359.1 | hypothetical protein | - |
| P1N06_RS16965 (3474390) | 3474390..3474590 | + | 201 | Protein_3296 | IS3 family transposase | - |
| P1N06_RS16970 (3474859) | 3474859..3475149 | + | 291 | WP_000855694.1 | DUF1778 domain-containing protein | Antitoxin |
| P1N06_RS16975 (3475146) | 3475146..3475673 | + | 528 | WP_000971655.1 | GNAT family N-acetyltransferase | Toxin |
| P1N06_RS16980 (3475746) | 3475746..3476169 | - | 424 | Protein_3299 | transposase | - |
| P1N06_RS16985 (3476396) | 3476396..3477052 | + | 657 | WP_000420459.1 | protein-serine/threonine phosphatase | - |
| P1N06_RS16990 (3477223) | 3477223..3477743 | - | 521 | Protein_3301 | cytoplasmic protein | - |
| P1N06_RS16995 (3477902) | 3477902..3480469 | + | 2568 | WP_001005807.1 | DNA mismatch repair protein MutS | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 3475746..3475940 | 194 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19069.91 Da Isoelectric Point: 9.6420
>T276247 WP_000971655.1 NZ_CP121297:3475146-3475673 [Salmonella enterica subsp. enterica]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6G96 | |
| PDB | 7AK9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3V8SJE7 |