Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
| Location | 536535..537111 | Replicon | chromosome |
| Accession | NZ_CP121297 | ||
| Organism | Salmonella enterica subsp. enterica strain KKP 1762 | ||
Toxin (Protein)
| Gene name | shpA | Uniprot ID | A0A4D6PC34 |
| Locus tag | P1N06_RS02435 | Protein ID | WP_020839635.1 |
| Coordinates | 536535..536822 (+) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | shpB | Uniprot ID | A0A6C6ZAR7 |
| Locus tag | P1N06_RS02440 | Protein ID | WP_000063143.1 |
| Coordinates | 536809..537111 (+) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1N06_RS02425 (531903) | 531903..535412 | - | 3510 | WP_076737682.1 | type I restriction-modification system endonuclease | - |
| P1N06_RS02430 (535610) | 535610..536282 | + | 673 | Protein_462 | winged helix-turn-helix domain-containing protein | - |
| P1N06_RS02435 (536535) | 536535..536822 | + | 288 | WP_020839635.1 | BrnT family toxin | Toxin |
| P1N06_RS02440 (536809) | 536809..537111 | + | 303 | WP_000063143.1 | BrnA antitoxin family protein | Antitoxin |
| P1N06_RS02445 (537186) | 537186..538142 | - | 957 | WP_000187838.1 | GTPase | - |
| P1N06_RS02450 (538153) | 538153..538356 | - | 204 | WP_000460616.1 | YbdD/YjiX family protein | - |
| P1N06_RS02455 (538451) | 538451..540601 | - | 2151 | WP_000379929.1 | pyruvate/proton symporter BtsT | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11241.75 Da Isoelectric Point: 8.0998
>T276241 WP_020839635.1 NZ_CP121297:536535-536822 [Salmonella enterica subsp. enterica]
MPMEFEWDANKAKSNLRKHGVRFEDAVLVFDDPRHLSRQERYENGEYRWQTLGLVHGIVVILVAHSVRFESGFEVICIIS
ARKADRKERNRYEHG
MPMEFEWDANKAKSNLRKHGVRFEDAVLVFDDPRHLSRQERYENGEYRWQTLGLVHGIVVILVAHSVRFESGFEVICIIS
ARKADRKERNRYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4D6PC34 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6C6ZAR7 |