Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 334629..335410 | Replicon | chromosome |
| Accession | NZ_CP121297 | ||
| Organism | Salmonella enterica subsp. enterica strain KKP 1762 | ||
Toxin (Protein)
| Gene name | TacT2 | Uniprot ID | A0A744N2R8 |
| Locus tag | P1N06_RS01450 | Protein ID | WP_061383248.1 |
| Coordinates | 334919..335410 (+) | Length | 164 a.a. |
Antitoxin (Protein)
| Gene name | TacA2 | Uniprot ID | B5R979 |
| Locus tag | P1N06_RS01445 | Protein ID | WP_001110452.1 |
| Coordinates | 334629..334922 (+) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1N06_RS01420 (330953) | 330953..331858 | + | 906 | WP_064042929.1 | YjiK family protein | - |
| P1N06_RS01425 (332153) | 332153..332527 | - | 375 | WP_232234247.1 | Ig-like domain-containing protein | - |
| P1N06_RS01430 (332667) | 332667..332954 | - | 288 | WP_001269916.1 | transcriptional regulator RtsB | - |
| P1N06_RS01435 (332951) | 332951..333826 | - | 876 | WP_278208502.1 | AraC family transcriptional regulator | - |
| P1N06_RS01440 (334090) | 334090..334312 | - | 223 | Protein_269 | hypothetical protein | - |
| P1N06_RS01445 (334629) | 334629..334922 | + | 294 | WP_001110452.1 | DUF1778 domain-containing protein | Antitoxin |
| P1N06_RS01450 (334919) | 334919..335410 | + | 492 | WP_061383248.1 | GNAT family N-acetyltransferase | Toxin |
| P1N06_RS01455 (335709) | 335709..336461 | - | 753 | WP_064042932.1 | non-specific acid phosphatase | - |
| P1N06_RS01460 (336561) | 336561..336637 | - | 77 | Protein_273 | porin family protein | - |
| P1N06_RS01465 (337017) | 337017..337091 | + | 75 | Protein_274 | helix-turn-helix domain-containing protein | - |
| P1N06_RS01475 (337363) | 337363..337938 | - | 576 | WP_001188509.1 | transcriptional regulator | - |
| P1N06_RS01480 (337975) | 337975..339678 | - | 1704 | WP_076737628.1 | protein-disulfide reductase DsbD | - |
| P1N06_RS01485 (339654) | 339654..340001 | - | 348 | WP_076737629.1 | divalent cation tolerance protein CutA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17649.45 Da Isoelectric Point: 7.7297
>T276239 WP_061383248.1 NZ_CP121297:334919-335410 [Salmonella enterica subsp. enterica]
MISTPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
MISTPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A744N2R8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 7AK7 | |
| AlphaFold DB | A0A5I1DGA4 |