Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 2360967..2361627 | Replicon | chromosome |
Accession | NZ_CP121296 | ||
Organism | Salmonella enterica subsp. enterica strain KKP 1213 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | Q57K70 |
Locus tag | P1838_RS11305 | Protein ID | WP_000244756.1 |
Coordinates | 2361214..2361627 (+) | Length | 138 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S5MU13 |
Locus tag | P1838_RS11300 | Protein ID | WP_000351186.1 |
Coordinates | 2360967..2361233 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P1838_RS11280 (2356896) | 2356896..2358329 | - | 1434 | WP_053444816.1 | 6-phospho-beta-glucosidase BglA | - |
P1838_RS11285 (2358487) | 2358487..2358798 | + | 312 | WP_001182976.1 | N(4)-acetylcytidine aminohydrolase | - |
P1838_RS11290 (2358962) | 2358962..2359621 | + | 660 | WP_053444817.1 | hemolysin III family protein | - |
P1838_RS11295 (2359737) | 2359737..2360717 | - | 981 | WP_000874178.1 | tRNA-modifying protein YgfZ | - |
P1838_RS11300 (2360967) | 2360967..2361233 | + | 267 | WP_000351186.1 | FAD assembly factor SdhE | Antitoxin |
P1838_RS11305 (2361214) | 2361214..2361627 | + | 414 | WP_000244756.1 | protein YgfX | Toxin |
P1838_RS11310 (2361680) | 2361680..2362201 | - | 522 | WP_001055885.1 | flavodoxin FldB | - |
P1838_RS11315 (2362314) | 2362314..2363210 | + | 897 | WP_000434302.1 | site-specific tyrosine recombinase XerD | - |
P1838_RS11320 (2363234) | 2363234..2363947 | + | 714 | WP_000745614.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
P1838_RS11325 (2363953) | 2363953..2365686 | + | 1734 | WP_278208069.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 16183.15 Da Isoelectric Point: 10.7537
>T276231 WP_000244756.1 NZ_CP121296:2361214-2361627 [Salmonella enterica subsp. enterica]
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3Z1E9V5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0YWH4 |