Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 1070002..1070783 | Replicon | chromosome |
| Accession | NZ_CP121296 | ||
| Organism | Salmonella enterica subsp. enterica strain KKP 1213 | ||
Toxin (Protein)
| Gene name | TacT2 | Uniprot ID | A0A744N2R8 |
| Locus tag | P1838_RS05255 | Protein ID | WP_061383248.1 |
| Coordinates | 1070002..1070493 (-) | Length | 164 a.a. |
Antitoxin (Protein)
| Gene name | TacA2 | Uniprot ID | B5R979 |
| Locus tag | P1838_RS05260 | Protein ID | WP_001110452.1 |
| Coordinates | 1070490..1070783 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1838_RS05220 (1065411) | 1065411..1065758 | + | 348 | WP_076737629.1 | divalent cation tolerance protein CutA | - |
| P1838_RS05225 (1065734) | 1065734..1067437 | + | 1704 | WP_076737628.1 | protein-disulfide reductase DsbD | - |
| P1838_RS05230 (1067474) | 1067474..1068049 | + | 576 | WP_001188509.1 | transcriptional regulator | - |
| P1838_RS05240 (1068321) | 1068321..1068395 | - | 75 | Protein_1015 | helix-turn-helix domain-containing protein | - |
| P1838_RS05245 (1068775) | 1068775..1068851 | + | 77 | Protein_1016 | porin family protein | - |
| P1838_RS05250 (1068951) | 1068951..1069703 | + | 753 | WP_064042932.1 | non-specific acid phosphatase | - |
| P1838_RS05255 (1070002) | 1070002..1070493 | - | 492 | WP_061383248.1 | GNAT family N-acetyltransferase | Toxin |
| P1838_RS05260 (1070490) | 1070490..1070783 | - | 294 | WP_001110452.1 | DUF1778 domain-containing protein | Antitoxin |
| P1838_RS05265 (1071100) | 1071100..1071322 | + | 223 | Protein_1020 | hypothetical protein | - |
| P1838_RS05270 (1071586) | 1071586..1072461 | + | 876 | WP_278208502.1 | AraC family transcriptional regulator | - |
| P1838_RS05275 (1072458) | 1072458..1072745 | + | 288 | WP_001269916.1 | transcriptional regulator RtsB | - |
| P1838_RS05280 (1072885) | 1072885..1073259 | + | 375 | WP_232234247.1 | Ig-like domain-containing protein | - |
| P1838_RS05285 (1073554) | 1073554..1074459 | - | 906 | WP_064042929.1 | YjiK family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17649.45 Da Isoelectric Point: 7.7297
>T276227 WP_061383248.1 NZ_CP121296:c1070493-1070002 [Salmonella enterica subsp. enterica]
MISTPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
MISTPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A744N2R8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 7AK7 | |
| AlphaFold DB | A0A5I1DGA4 |