Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 963221..963864 | Replicon | chromosome |
Accession | NZ_CP121296 | ||
Organism | Salmonella enterica subsp. enterica strain KKP 1213 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | B5F3H8 |
Locus tag | P1838_RS04690 | Protein ID | WP_000048134.1 |
Coordinates | 963448..963864 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | B5F3H9 |
Locus tag | P1838_RS04685 | Protein ID | WP_001261294.1 |
Coordinates | 963221..963451 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P1838_RS04675 (960235) | 960235..962373 | + | 2139 | WP_000187818.1 | anaerobic ribonucleoside-triphosphate reductase | - |
P1838_RS04680 (962590) | 962590..963054 | + | 465 | WP_076737652.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
P1838_RS04685 (963221) | 963221..963451 | + | 231 | WP_001261294.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
P1838_RS04690 (963448) | 963448..963864 | + | 417 | WP_000048134.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
P1838_RS04695 (963925) | 963925..965838 | - | 1914 | WP_149866235.1 | BglG family transcription antiterminator | - |
P1838_RS04700 (965855) | 965855..966595 | - | 741 | WP_048591337.1 | KDGP aldolase family protein | - |
P1838_RS04705 (966592) | 966592..967710 | - | 1119 | WP_076737650.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
P1838_RS04710 (967694) | 967694..968827 | - | 1134 | WP_076737649.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15135.50 Da Isoelectric Point: 8.1381
>T276226 WP_000048134.1 NZ_CP121296:963448-963864 [Salmonella enterica subsp. enterica]
MSKTYMLDTCICSFIMREQPEAVLKRLEQAVLRRHRIVVSAITYAEMRFGCTGKKASPRHAQLVDAFCSRLDAVLAWDRA
AVDATTEIRAVLAAAGTPIGSNDAAIAGHAIASGAILVTNNVREFERVPGLQYEDWVK
MSKTYMLDTCICSFIMREQPEAVLKRLEQAVLRRHRIVVSAITYAEMRFGCTGKKASPRHAQLVDAFCSRLDAVLAWDRA
AVDATTEIRAVLAAAGTPIGSNDAAIAGHAIASGAILVTNNVREFERVPGLQYEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2T8L749 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V4SIC2 |