Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
| Location | 868292..868868 | Replicon | chromosome |
| Accession | NZ_CP121296 | ||
| Organism | Salmonella enterica subsp. enterica strain KKP 1213 | ||
Toxin (Protein)
| Gene name | shpA | Uniprot ID | A0A4D6PC34 |
| Locus tag | P1838_RS04255 | Protein ID | WP_020839635.1 |
| Coordinates | 868581..868868 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | shpB | Uniprot ID | A0A6C6ZAR7 |
| Locus tag | P1838_RS04250 | Protein ID | WP_000063143.1 |
| Coordinates | 868292..868594 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1838_RS04235 (864802) | 864802..866952 | + | 2151 | WP_000379929.1 | pyruvate/proton symporter BtsT | - |
| P1838_RS04240 (867047) | 867047..867250 | + | 204 | WP_000460616.1 | YbdD/YjiX family protein | - |
| P1838_RS04245 (867261) | 867261..868217 | + | 957 | WP_000187838.1 | GTPase | - |
| P1838_RS04250 (868292) | 868292..868594 | - | 303 | WP_000063143.1 | BrnA antitoxin family protein | Antitoxin |
| P1838_RS04255 (868581) | 868581..868868 | - | 288 | WP_020839635.1 | BrnT family toxin | Toxin |
| P1838_RS04260 (869121) | 869121..869793 | - | 673 | Protein_824 | winged helix-turn-helix domain-containing protein | - |
| P1838_RS04265 (869991) | 869991..873500 | + | 3510 | WP_076737682.1 | type I restriction-modification system endonuclease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11241.75 Da Isoelectric Point: 8.0998
>T276225 WP_020839635.1 NZ_CP121296:c868868-868581 [Salmonella enterica subsp. enterica]
MPMEFEWDANKAKSNLRKHGVRFEDAVLVFDDPRHLSRQERYENGEYRWQTLGLVHGIVVILVAHSVRFESGFEVICIIS
ARKADRKERNRYEHG
MPMEFEWDANKAKSNLRKHGVRFEDAVLVFDDPRHLSRQERYENGEYRWQTLGLVHGIVVILVAHSVRFESGFEVICIIS
ARKADRKERNRYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4D6PC34 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6C6ZAR7 |