Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 315607..316227 | Replicon | chromosome |
Accession | NZ_CP121296 | ||
Organism | Salmonella enterica subsp. enterica strain KKP 1213 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | P1838_RS01675 | Protein ID | WP_001280991.1 |
Coordinates | 316009..316227 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | P1838_RS01670 | Protein ID | WP_000344807.1 |
Coordinates | 315607..315981 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P1838_RS01660 (310746) | 310746..311939 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
P1838_RS01665 (311962) | 311962..315111 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
P1838_RS01670 (315607) | 315607..315981 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
P1838_RS01675 (316009) | 316009..316227 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
P1838_RS01680 (316406) | 316406..316957 | + | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
P1838_RS01685 (317073) | 317073..317543 | + | 471 | WP_080170962.1 | YlaC family protein | - |
P1838_RS01690 (317599) | 317599..317739 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
P1838_RS01695 (317745) | 317745..318005 | - | 261 | WP_000801421.1 | type B 50S ribosomal protein L31 | - |
P1838_RS01700 (318230) | 318230..319780 | + | 1551 | WP_023210786.1 | EAL domain-containing protein | - |
P1838_RS01710 (320011) | 320011..320400 | + | 390 | WP_278208425.1 | MGMT family protein | - |
P1838_RS01715 (320433) | 320433..321002 | - | 570 | WP_000779801.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T276224 WP_001280991.1 NZ_CP121296:316009-316227 [Salmonella enterica subsp. enterica]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT276224 WP_000344807.1 NZ_CP121296:315607-315981 [Salmonella enterica subsp. enterica]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|